Detail information of JCDBG00076

JCDBG00076
ID
JCDBG00076
Name
rps8
Type
protein_coding
Scaffold
NC_012224.1
Start
86689
End
87093
Strand
-
Link
Genbank id:7564769
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
Biological process
GO:0006412 | translation
KEGG
Entry: K02994
Name: RP-S8, rpsH
Definition: small subunit ribosomal protein S8
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
CATGGGTAGGGATTCTATTGCTGAAATAATAACCTCTATACGAAATACTGACATGAATAGAAAAGGAACTGTTCGAATAG CATCTACTAATATCACCGAAAACATTATTAAAATACTTTTACGAGAAGGTTTTATTGAAAATGTCAGGAAACATCAGGAA GGCAACAAAAAATTTTTGGTCTTAACCCTACGACATAGAAGGAAGATGAAAGGGCCATATAGAACTAGTCTAAATTTAAA ACGAATCAGCCGACCTAGTCTACGAATCTATCCTAACTATCAAAAAATTCCTAGAATTTTGGGCGGGATGGGGATTGTAA TTCTTTCTACTTCTCGGGGTATAATGACAGACCGAGAAGCTCGACTAGAAAGAATCGGTGGAGAAATCTTGTGTTATATA TGGTA
Gene structure

JCDB Genes gff download

JCDBG00076 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00076's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00076JCDBG00074co-exp0.954077
JCDBG00076JCDBG00015co-exp0.930852
JCDBG00076JCDBG00014co-exp0.927644
JCDBG00076JCDBG00073co-exp0.907254
JCDBG00076JCDBG00016co-exp0.885852
JCDBG00076JCDBG00042co-exp0.878569
JCDBG00076JCDBG00100co-exp0.852873
JCDBG00076JCDBG00017co-exp0.827276
JCDBG00076JCDBG00066co-exp0.790643
JCDBG00076JCDBG00029co-exp0.780435
JCDBG00074JCDBG00015co-exp0.915663
JCDBG00074JCDBG00014co-exp0.908064
JCDBG00074JCDBG00073co-exp0.919097
JCDBG00074JCDBG00016co-exp0.898756
JCDBG00074JCDBG00042co-exp0.855675
JCDBG00074JCDBG00100co-exp0.80827
JCDBG00074JCDBG00017co-exp0.864342
JCDBG00074JCDBG00066co-exp0.812118
JCDBG00074JCDBG00029co-exp0.721363
JCDBG00015JCDBG00014co-exp0.962428
JCDBG00015JCDBG00073co-exp0.832888
JCDBG00015JCDBG00016co-exp0.940419
JCDBG00015JCDBG00042co-exp0.895991
JCDBG00015JCDBG00100co-exp0.823086
JCDBG00015JCDBG00017co-exp0.837062
JCDBG00015JCDBG00066co-exp0.817076
JCDBG00015JCDBG00029co-exp0.810684
JCDBG00014JCDBG00073co-exp0.847308
JCDBG00014JCDBG00016co-exp0.880861
JCDBG00014JCDBG00042co-exp0.895739
JCDBG00014JCDBG00100co-exp0.790546
JCDBG00014JCDBG00017co-exp0.844381
JCDBG00014JCDBG00066co-exp0.856988
JCDBG00014JCDBG00029co-exp0.879308
JCDBG00073JCDBG00016co-exp0.842042
JCDBG00073JCDBG00042co-exp0.877775
JCDBG00073JCDBG00100co-exp0.863882
JCDBG00073JCDBG00017co-exp0.843437
JCDBG00073JCDBG00066co-exp0.745586
JCDBG00073JCDBG00029co-exp0.64327
JCDBG00016JCDBG00042co-exp0.87673
JCDBG00016JCDBG00100co-exp0.848717
JCDBG00016JCDBG00017co-exp0.87755
JCDBG00016JCDBG00066co-exp0.814743
JCDBG00016JCDBG00029co-exp0.65824
JCDBG00042JCDBG00100co-exp0.91609
JCDBG00042JCDBG00017co-exp0.821724
JCDBG00042JCDBG00066co-exp0.761356
JCDBG00042JCDBG00029co-exp0.738498
JCDBG00100JCDBG00017co-exp0.742444
JCDBG00100JCDBG00066co-exp0.635237
JCDBG00100JCDBG00029co-exp0.6062
JCDBG00017JCDBG00066co-exp0.924073
JCDBG00017JCDBG00029co-exp0.678798
JCDBG00066JCDBG00029co-exp0.741453
PPI network
node1node2type
JCDBG00076JCDBG24182PPI
JCDBG00076JCDBG17434PPI
JCDBG00076JCDBG23530PPI
JCDBG00076JCDBG18937PPI
JCDBG00076JCDBG19737PPI
JCDBG00076JCDBG23997PPI
JCDBG00076JCDBG08468PPI
JCDBG00076JCDBG23734PPI
JCDBG00076JCDBG22121PPI
JCDBG00076JCDBG03587PPI
JCDBG00076JCDBG12412PPI
JCDBG24182JCDBG17434PPI
JCDBG24182JCDBG23530PPI
JCDBG24182JCDBG23997PPI
JCDBG24182JCDBG08468PPI
JCDBG24182JCDBG23734PPI
JCDBG24182JCDBG03587PPI
JCDBG17434JCDBG23530PPI
JCDBG17434JCDBG19737PPI
JCDBG23530JCDBG19737PPI
JCDBG23530JCDBG03587PPI
JCDBG19737JCDBG23997PPI
JCDBG08468JCDBG03587PPI
JCDBR00076
ID
JCDBR00076
Name
rps8
Type
protein_coding
Scaffold
NC_012224.1
Start
86689
End
87093
Strand
-
Exon
86689-87093
Sequence
CATGGGTAGGGATTCTATTGCTGAAATAATAACCTCTATACGAAATACTGACATGAATAGAAAAGGAACTGTTCGAATAG CATCTACTAATATCACCGAAAACATTATTAAAATACTTTTACGAGAAGGTTTTATTGAAAATGTCAGGAAACATCAGGAA GGCAACAAAAAATTTTTGGTCTTAACCCTACGACATAGAAGGAAGATGAAAGGGCCATATAGAACTAGTCTAAATTTAAA ACGAATCAGCCGACCTAGTCTACGAATCTATCCTAACTATCAAAAAATTCCTAGAATTTTGGGCGGGATGGGGATTGTAA TTCTTTCTACTTCTCGGGGTATAATGACAGACCGAGAAGCTCGACTAGAAAGAATCGGTGGAGAAATCTTGTGTTATATA TGGTA
Product
Source
RefSeq
Link:
JCDBP00054
ID
JCDBP00054
Parent
JCDBR00076
Name
YP_002720147.1
Scaffold
NC_012224.1
CDS
86689-87093
Strand:
-
Sequence
MGRDSIAEIITSIRNTDMNRKGTVRIASTNITENIIKILLREGFIENVRKHQEGNKKFLVLTLRHRRKMKGPYRTSLNLK RISRPSLRIYPNYQKIPRILGGMGIVILSTSRGIMTDREARLERIGGEILCYIW
Product
ribosomal protein S8
Source
RefSeq
Link
YP_002720147.1
InterProScan
IPR000630 Ribosomal protein S8
Pfam
PF00410.15 Ribosomal_S8 Domain