Detail information of JCDBG00077

JCDBG00077
ID
JCDBG00077
Name
rpl14
Type
protein_coding
Scaffold
NC_012224.1
Start
87606
End
87974
Strand
-
Link
Genbank id:7564770
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0015934 | large ribosomal subunit
Biological process
GO:0006412 | translation
KEGG
Entry: K02874
Name: RP-L14, MRPL14, rplN
Definition: large subunit ribosomal protein L14
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TATGATCCAATCTCAAACCCATTTGAATGTAGCAGATAACAGTGGAGCCCGAGAATTGATGTGTATTCGAATCATGGGGA CTAGTAATCGACGATATGCTCATATTGGTGACGTTATTGTTGCTGTGATCAAGGAAGCAACACCAAATTCACCTCTAGAA AGATCCGAAGTAATAAGAGCTGTAATTGTACGTACTTGTAAAGAACTCAAACGCGATAACGGTATAATAATACGATATGA TGATAATGCTGCAGTTGTTATTGATCAAGAAGGAAATCCAAAAGGAACTCGAATTTTTGGTGCAATCGCCCGGGAATTGA GACAGTTAAATTTTACTAAAATAGTTTCATTAGCACCCGAAGTATTATA
Gene structure

JCDB Genes gff download

JCDBG00077 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00077's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
PPI network
node1node2type
JCDBG00077JCDBG09324PPI
JCDBG00077JCDBG14958PPI
JCDBG00077JCDBG12829PPI
JCDBG00077JCDBG23880PPI
JCDBG00077JCDBG08056PPI
JCDBG00077JCDBG24244PPI
JCDBG00077JCDBG23469PPI
JCDBG00077JCDBG08044PPI
JCDBG00077JCDBG11772PPI
JCDBG00077JCDBG07827PPI
JCDBG00077JCDBG06148PPI
JCDBG00077JCDBG19378PPI
JCDBG00077JCDBG12078PPI
JCDBG00077JCDBG23734PPI
JCDBG00077JCDBG08042PPI
JCDBG00077JCDBG03587PPI
JCDBG00077JCDBG20354PPI
JCDBG09324JCDBG14958PPI
JCDBG09324JCDBG23880PPI
JCDBG09324JCDBG06148PPI
JCDBG14958JCDBG23880PPI
JCDBG14958JCDBG06148PPI
JCDBG12829JCDBG06148PPI
JCDBG23880JCDBG23469PPI
JCDBG23880JCDBG08044PPI
JCDBG23880JCDBG06148PPI
JCDBG23880JCDBG23734PPI
JCDBG23880JCDBG08042PPI
JCDBG23880JCDBG03587PPI
JCDBG23880JCDBG20354PPI
JCDBG23469JCDBG06148PPI
JCDBG23469JCDBG03587PPI
JCDBG08044JCDBG23734PPI
JCDBG07827JCDBG08042PPI
JCDBG06148JCDBG23734PPI
JCDBG06148JCDBG03587PPI
JCDBR00077
ID
JCDBR00077
Name
rpl14
Type
protein_coding
Scaffold
NC_012224.1
Start
87606
End
87974
Strand
-
Exon
87606-87974
Sequence
TATGATCCAATCTCAAACCCATTTGAATGTAGCAGATAACAGTGGAGCCCGAGAATTGATGTGTATTCGAATCATGGGGA CTAGTAATCGACGATATGCTCATATTGGTGACGTTATTGTTGCTGTGATCAAGGAAGCAACACCAAATTCACCTCTAGAA AGATCCGAAGTAATAAGAGCTGTAATTGTACGTACTTGTAAAGAACTCAAACGCGATAACGGTATAATAATACGATATGA TGATAATGCTGCAGTTGTTATTGATCAAGAAGGAAATCCAAAAGGAACTCGAATTTTTGGTGCAATCGCCCGGGAATTGA GACAGTTAAATTTTACTAAAATAGTTTCATTAGCACCCGAAGTATTATA
Product
Source
RefSeq
Link:
JCDBP00055
ID
JCDBP00055
Parent
JCDBR00077
Name
YP_002720148.1
Scaffold
NC_012224.1
CDS
87606-87974
Strand:
-
Sequence
MIQSQTHLNVADNSGARELMCIRIMGTSNRRYAHIGDVIVAVIKEATPNSPLERSEVIRAVIVRTCKELKRDNGIIIRYD DNAAVVIDQEGNPKGTRIFGAIARELRQLNFTKIVSLAPEVL
Product
ribosomal protein L14
Source
RefSeq
Link
YP_002720148.1
InterProScan
IPR000218 Ribosomal protein L14P
IPR005745 Ribosomal protein L14P, bacterial-type
IPR019972 Ribosomal protein L14P, conserved site
Pfam
PF00238.15 Ribosomal_L14 Domain