Detail information of JCDBG00078

JCDBG00078
ID
JCDBG00078
Name
rpl16
Type
protein_coding
Scaffold
NC_012224.1
Start
88089
End
89891
Strand
-
Link
Genbank id:7564771
Molecular function
GO:0003735 | structural constituent of ribosome
GO:0019843 | rRNA binding
Cellular component
GO:0005840 | ribosome
GO:0005622 | intracellular
Biological process
GO:0006412 | translation
KEGG
Entry: K02878
Name: RP-L16, MRPL16, rplP
Definition: large subunit ribosomal protein L16
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TATGCTTAGTGTGCGACTCGTTGGGTTTTTATTTTAGGGTCAGGGTTAAAAAAAAAGGACTGACCTGTACTATGAACTAA AAATATAAGTAAGTATGCAACTAATAACCAGCCCAGCGCTTTGTAGTATCTCGATCCAAAGAAATTGTCAAGACATGATA TATTAGCCATATCATTGTAGCCATTGAAATTCTTTTTGCACAAACAAAAGAAAAACCAATCTGATTATGAGTTGTAAATC AAAATATAAAATTAGATAGATAAGTGGAAGGGTGAAAGAAAGAGAGAAAGAGAGAAAAAGAATATCAATGATATATGATT CTAATATGTAAGGTCTATGAGTCATCACATAAAAATTATAAAAATTAATGTAATAAAGCAGCAATACCAATTGATTTATA ATTAAACTAATCTGTTCATACTGTTCTACTAAAAATAAAAAAAAAAAAAAAAAGAGCCTCGAGTCAATAAAGACTAAGCA GATTGACTCAAAGACAAGCTTCATTAGAGGCTCCATTGTAAAATTAAGACCTAAGCATTAATGAAGAAGCGATGGGAACG ACGGAACCTATAATATTTTATTGATTTATTGAAAAAAAAATCATAATAATTTTTTGCTTTTGGCGGGATAGCGAAAGGTA CCAGAAGACTAATTTAGTCTGAGAGATCATACCCAGACTATCTCTACAAATGAAATAAATATTGAAAGAGTCAATATTCG CGCGCGAAGTTTTTTTATATTCTAAAGTAGAATTTTTTCTATTAGAATTATGATATCAGAATTATGATATCAGATTGCTC AAATTTAGAAATCCAATAATAGAAAAATAGAAAAAAATAAGATTATGTAAAATAATGCAAAACAAAATAAAATAGAAAAA ATTATCTATAATAAAAATTATCTATAATATAATAATATAAATAATAATAAAAAAAAAAAGGAAAAAATAACTATATAAAA AAATAACTATATAATAAATAATAACTATAACTACATATATATAATATATATATATAGTTATATAAATTTATATAGTTATA TAATATAGATATAATATAGTTATAGTTAAAATAGAAAATATATATAATAAAAATTTCTATTCTACTAATCTAATCAAAAT TCTAATAAAAATACTAATCTAATAAAAAAAACTAATCTAATAAAAATAGATCTAATAAATAGATTAGATTAAGTAAATAG ATTAAGCGTAAATAGATTAAGCGAAATCTCAAAGAATTCCACGATTTAGTATATTATTTTATTCAGCAAACGCATGTATA TTTTTTTTCTTTTATCATTTCATTCGCGAGGAGCTGGATGAGAAGAAACTCTCATGTCCGGCTCTGTAGTAGAGATGGAG TGGCTGTAGTAGAGATGGGCTTGAGAAACAAGCATCACCTACAACCCCCAAAGGCCCCGATTCCGCAAACAGCATAGAGG ACGAATGAAAGGAAAAGCTTTTCGAGCTAATCGTATTTCTTTCGGTAGATATGCTCTTCAGGCACTTGAACCTTCTTGGA TTACATCTAGGCAAATAGAAGCGGGGCGACGAACAATGACACGAAATGCACGTCGCGGTGGAAAAATATGGATACGTATA TTTCCCGACAAACCAATTACTTTAAGACCTACGGAAACACGTATGGGTTCGGGGAAAGGATCTCCCGAATATTGGGTAGC TGTCGTTAAACCAGGTAGAATCCTTTATGAAATGGGTGGAGTAGCAGAAAATATAGCGAGAAAATCTATTTCAATAACAG CATCAAAAATGCCTGTACGAACTCAACTCATTATTTCGGTATA
Gene structure

JCDB Genes gff download

JCDBG00078 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00078's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
PPI network
node1node2type
JCDBG00078JCDBG19958PPI
JCDBG00078JCDBG20744PPI
JCDBG00078JCDBG13892PPI
JCDBG00078JCDBG00387PPI
JCDBG00078JCDBG23530PPI
JCDBG00078JCDBG15355PPI
JCDBG00078JCDBG15442PPI
JCDBG00078JCDBG00883PPI
JCDBG00078JCDBG23997PPI
JCDBG00078JCDBG06935PPI
JCDBG00078JCDBG03794PPI
JCDBG00078JCDBG07554PPI
JCDBG00078JCDBG09118PPI
JCDBG00078JCDBG23469PPI
JCDBG00078JCDBG18461PPI
JCDBG00078JCDBG11420PPI
JCDBG00078JCDBG08468PPI
JCDBG00078JCDBG12855PPI
JCDBG00078JCDBG19489PPI
JCDBG00078JCDBG06148PPI
JCDBG00078JCDBG23557PPI
JCDBG00078JCDBG17192PPI
JCDBG00078JCDBG19222PPI
JCDBG00078JCDBG17821PPI
JCDBG00078JCDBG03326PPI
JCDBG00078JCDBG21777PPI
JCDBG00078JCDBG19936PPI
JCDBG00078JCDBG06075PPI
JCDBG00078JCDBG03587PPI
JCDBG20744JCDBG23557PPI
JCDBG13892JCDBG15355PPI
JCDBG13892JCDBG06935PPI
JCDBG13892JCDBG11420PPI
JCDBG00387JCDBG15355PPI
JCDBG00387JCDBG00883PPI
JCDBG00387JCDBG03794PPI
JCDBG00387JCDBG09118PPI
JCDBG00387JCDBG18461PPI
JCDBG00387JCDBG11420PPI
JCDBG00387JCDBG06148PPI
JCDBG00387JCDBG17821PPI
JCDBG00387JCDBG19936PPI
JCDBG00387JCDBG06075PPI
JCDBG23530JCDBG06935PPI
JCDBG23530JCDBG03794PPI
JCDBG23530JCDBG23469PPI
JCDBG23530JCDBG06148PPI
JCDBG23530JCDBG23557PPI
JCDBG23530JCDBG19936PPI
JCDBG23530JCDBG03587PPI
JCDBG15355JCDBG00883PPI
JCDBG15355JCDBG03794PPI
JCDBG15355JCDBG09118PPI
JCDBG15355JCDBG18461PPI
JCDBG15355JCDBG06148PPI
JCDBG15355JCDBG17821PPI
JCDBG15355JCDBG19936PPI
JCDBG15355JCDBG06075PPI
JCDBG15442JCDBG07554PPI
JCDBG15442JCDBG18461PPI
JCDBG15442JCDBG17821PPI
JCDBG00883JCDBG03794PPI
JCDBG00883JCDBG09118PPI
JCDBG00883JCDBG18461PPI
JCDBG00883JCDBG11420PPI
JCDBG00883JCDBG06148PPI
JCDBG00883JCDBG23557PPI
JCDBG00883JCDBG17821PPI
JCDBG00883JCDBG19936PPI
JCDBG00883JCDBG06075PPI
JCDBG23997JCDBG03794PPI
JCDBG23997JCDBG06148PPI
JCDBG23997JCDBG06075PPI
JCDBG06935JCDBG23557PPI
JCDBG03794JCDBG09118PPI
JCDBG03794JCDBG23469PPI
JCDBG03794JCDBG18461PPI
JCDBG03794JCDBG11420PPI
JCDBG03794JCDBG06148PPI
JCDBG03794JCDBG17821PPI
JCDBG03794JCDBG19936PPI
JCDBG03794JCDBG06075PPI
JCDBG03794JCDBG03587PPI
JCDBG07554JCDBG18461PPI
JCDBG07554JCDBG17821PPI
JCDBG09118JCDBG18461PPI
JCDBG09118JCDBG11420PPI
JCDBG09118JCDBG17821PPI
JCDBG09118JCDBG19936PPI
JCDBG09118JCDBG06075PPI
JCDBG23469JCDBG06148PPI
JCDBG23469JCDBG17821PPI
JCDBG23469JCDBG19936PPI
JCDBG23469JCDBG06075PPI
JCDBG23469JCDBG03587PPI
JCDBG18461JCDBG11420PPI
JCDBG18461JCDBG06148PPI
JCDBG18461JCDBG19222PPI
JCDBG18461JCDBG17821PPI
JCDBG18461JCDBG19936PPI
JCDBG18461JCDBG06075PPI
JCDBG11420JCDBG06148PPI
JCDBG11420JCDBG17821PPI
JCDBG11420JCDBG19936PPI
JCDBG11420JCDBG06075PPI
JCDBG08468JCDBG06148PPI
JCDBG08468JCDBG17821PPI
JCDBG08468JCDBG06075PPI
JCDBG08468JCDBG03587PPI
JCDBG06148JCDBG17821PPI
JCDBG06148JCDBG19936PPI
JCDBG06148JCDBG06075PPI
JCDBG06148JCDBG03587PPI
JCDBG17192JCDBG19936PPI
JCDBG17821JCDBG19936PPI
JCDBG17821JCDBG06075PPI
JCDBG06075JCDBG03587PPI
JCDBR00078
ID
JCDBR00078
Name
rpl16
Type
protein_coding
Scaffold
NC_012224.1
Start
88089
End
89891
Strand
-
Exon
88089-88487,89883-89891
Sequence
TATGCTTAGTGTGCGACTCGTTGGGTTTTTATTTTAGGGTCAGGGTTAAAAAAAAAGGACTGACCTGTACTATGAACTAA AAATATAAGTAAGTATGCAACTAATAACCAGCCCAGCGCTTTGTAGTATCTCGATCCAAAGAAATTGTCAAGACATGATA TATTAGCCATATCATTGTAGCCATTGAAATTCTTTTTGCACAAACAAAAGAAAAACCAATCTGATTATGAGTTGTAAATC AAAATATAAAATTAGATAGATAAGTGGAAGGGTGAAAGAAAGAGAGAAAGAGAGAAAAAGAATATCAATGATATATGATT CTAATATGTAAGGTCTATGAGTCATCACATAAAAATTATAAAAATTAATGTAATAAAGCAGCAATACCAATTGATTTATA ATTAAACTAATCTGTTCATACTGTTCTACTAAAAATAAAAAAAAAAAAAAAAAGAGCCTCGAGTCAATAAAGACTAAGCA GATTGACTCAAAGACAAGCTTCATTAGAGGCTCCATTGTAAAATTAAGACCTAAGCATTAATGAAGAAGCGATGGGAACG ACGGAACCTATAATATTTTATTGATTTATTGAAAAAAAAATCATAATAATTTTTTGCTTTTGGCGGGATAGCGAAAGGTA CCAGAAGACTAATTTAGTCTGAGAGATCATACCCAGACTATCTCTACAAATGAAATAAATATTGAAAGAGTCAATATTCG CGCGCGAAGTTTTTTTATATTCTAAAGTAGAATTTTTTCTATTAGAATTATGATATCAGAATTATGATATCAGATTGCTC AAATTTAGAAATCCAATAATAGAAAAATAGAAAAAAATAAGATTATGTAAAATAATGCAAAACAAAATAAAATAGAAAAA ATTATCTATAATAAAAATTATCTATAATATAATAATATAAATAATAATAAAAAAAAAAAGGAAAAAATAACTATATAAAA AAATAACTATATAATAAATAATAACTATAACTACATATATATAATATATATATATAGTTATATAAATTTATATAGTTATA TAATATAGATATAATATAGTTATAGTTAAAATAGAAAATATATATAATAAAAATTTCTATTCTACTAATCTAATCAAAAT TCTAATAAAAATACTAATCTAATAAAAAAAACTAATCTAATAAAAATAGATCTAATAAATAGATTAGATTAAGTAAATAG ATTAAGCGTAAATAGATTAAGCGAAATCTCAAAGAATTCCACGATTTAGTATATTATTTTATTCAGCAAACGCATGTATA TTTTTTTTCTTTTATCATTTCATTCGCGAGGAGCTGGATGAGAAGAAACTCTCATGTCCGGCTCTGTAGTAGAGATGGAG TGGCTGTAGTAGAGATGGGCTTGAGAAACAAGCATCACCTACAACCCCCAAAGGCCCCGATTCCGCAAACAGCATAGAGG ACGAATGAAAGGAAAAGCTTTTCGAGCTAATCGTATTTCTTTCGGTAGATATGCTCTTCAGGCACTTGAACCTTCTTGGA TTACATCTAGGCAAATAGAAGCGGGGCGACGAACAATGACACGAAATGCACGTCGCGGTGGAAAAATATGGATACGTATA TTTCCCGACAAACCAATTACTTTAAGACCTACGGAAACACGTATGGGTTCGGGGAAAGGATCTCCCGAATATTGGGTAGC TGTCGTTAAACCAGGTAGAATCCTTTATGAAATGGGTGGAGTAGCAGAAAATATAGCGAGAAAATCTATTTCAATAACAG CATCAAAAATGCCTGTACGAACTCAACTCATTATTTCGGTATA
Product
Source
RefSeq
Link:
JCDBP00056
ID
JCDBP00056
Parent
JCDBR00078
Name
YP_002720149.1
Scaffold
NC_012224.1
CDS
88089-88487,89883-89891
Strand:
-
Sequence
MLSPQRPRFRKQHRGRMKGKAFRANRISFGRYALQALEPSWITSRQIEAGRRTMTRNARRGGKIWIRIFPDKPITLRPTE TRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKSISITASKMPVRTQLIISV
Product
ribosomal protein L16
Source
RefSeq
Link
YP_002720149.1
InterProScan
IPR000114 Ribosomal protein L16
IPR016180 Ribosomal protein L10e/L16
IPR020798 Ribosomal protein L16, conserved site
Pfam
PF00252.14 Ribosomal_L16 Family