Detail information of JCDBG00079

JCDBG00079
ID
JCDBG00079
Name
rps3
Type
protein_coding
Scaffold
NC_012224.1
Start
90100
End
90765
Strand
-
Link
Genbank id:7564772
Molecular function
GO:0003723 | RNA binding
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0015935 | small ribosomal subunit
Biological process
GO:0006412 | translation
KEGG
Entry: K02982
Name: RP-S3, rpsC
Definition: small subunit ribosomal protein S3
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TATGGGACAAAAAATAAATCCACTTGGTTTCAGACTTGGTACAACTCAAAGTCATCATTCTCTTTGGTTTGCACAACCAA AAAATTATTCTGAGGATCTACAAGAAGATCAAAAAATAAGAAACTGTATCAAAAATTATGTAAAACAAAATACGAAAATA TCTTCTGGTGTTGAGGGAATTGCACGTATAGAGATTCAAAAACGAATCGATGTGATTCAGGTCATGATATATATGGGATT CCAAAAATTATTAATGGAAGGTAGACCTAAACAAATCGAAGAATTACAGATGAATGTACAAAAAGAACTTAATTATGTGA ACCGAAAACTCAATATTGCTATTAAAATTAAAAGAATTTCAAATCCTTATGGGCAACCTAATATTCTTGCAGAATTTATA GCCGGGCAGTTAAAGAATAGAGTTTCATTTCGCAAAGCAATGAAAAAAGCTATTGAATTAACTGAACAAACGGATACAAA AGGAATTCAAGTCCAAATTGCGGGGCGTCTTGACGGAAAAGAAATTGCACGCGTCGAATGGATTAGAGAGGGTAGAGTTC CTTTACAAACCATTCAAGCTAAAATTGAGTATTGTTCGTATACAGTTAAAACTATTTATGGGGTATTAGGCATAAAAATT TGGACATTTCTAGATAAAAAAGAATA
Gene structure

JCDB Genes gff download

JCDBG00079 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00079's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00079JCDBG00082co-exp0.657144
JCDBG00079JCDBG00022co-exp0.626696
JCDBG00079JCDBG00075co-exp0.620646
JCDBG00082JCDBG00022co-exp0.650934
JCDBG00082JCDBG00075co-exp0.696311
JCDBG00022JCDBG00075co-exp0.72397
PPI network
node1node2type
JCDBG00079JCDBG24182PPI
JCDBG00079JCDBG16654PPI
JCDBG00079JCDBG09324PPI
JCDBG00079JCDBG15890PPI
JCDBG00079JCDBG21060PPI
JCDBG00079JCDBG14958PPI
JCDBG00079JCDBG00652PPI
JCDBG00079JCDBG17434PPI
JCDBG00079JCDBG01948PPI
JCDBG00079JCDBG07608PPI
JCDBG00079JCDBG21369PPI
JCDBG00079JCDBG23530PPI
JCDBG00079JCDBG05767PPI
JCDBG00079JCDBG09043PPI
JCDBG00079JCDBG12505PPI
JCDBG00079JCDBG08740PPI
JCDBG00079JCDBG19729PPI
JCDBG00079JCDBG23880PPI
JCDBG00079JCDBG13802PPI
JCDBG00079JCDBG19929PPI
JCDBG00079JCDBG20140PPI
JCDBG00079JCDBG23997PPI
JCDBG00079JCDBG08746PPI
JCDBG00079JCDBG23469PPI
JCDBG00079JCDBG08044PPI
JCDBG00079JCDBG24155PPI
JCDBG00079JCDBG24974PPI
JCDBG00079JCDBG17129PPI
JCDBG00079JCDBG08468PPI
JCDBG00079JCDBG22653PPI
JCDBG00079JCDBG21747PPI
JCDBG00079JCDBG06148PPI
JCDBG00079JCDBG08991PPI
JCDBG00079JCDBG00306PPI
JCDBG00079JCDBG11027PPI
JCDBG00079JCDBG00558PPI
JCDBG00079JCDBG17192PPI
JCDBG00079JCDBG15810PPI
JCDBG00079JCDBG07119PPI
JCDBG00079JCDBG13807PPI
JCDBG00079JCDBG09074PPI
JCDBG00079JCDBG20457PPI
JCDBG00079JCDBG23734PPI
JCDBG00079JCDBG19936PPI
JCDBG00079JCDBG18629PPI
JCDBG00079JCDBG12398PPI
JCDBG00079JCDBG23113PPI
JCDBG00079JCDBG22121PPI
JCDBG00079JCDBG09698PPI
JCDBG00079JCDBG03587PPI
JCDBG00079JCDBG20354PPI
JCDBG24182JCDBG16654PPI
JCDBG24182JCDBG09324PPI
JCDBG24182JCDBG14958PPI
JCDBG24182JCDBG17434PPI
JCDBG24182JCDBG21369PPI
JCDBG24182JCDBG23530PPI
JCDBG24182JCDBG12505PPI
JCDBG24182JCDBG23880PPI
JCDBG24182JCDBG13802PPI
JCDBG24182JCDBG19929PPI
JCDBG24182JCDBG20140PPI
JCDBG24182JCDBG23997PPI
JCDBG24182JCDBG23469PPI
JCDBG24182JCDBG08044PPI
JCDBG24182JCDBG17129PPI
JCDBG24182JCDBG08468PPI
JCDBG24182JCDBG22653PPI
JCDBG24182JCDBG21747PPI
JCDBG24182JCDBG06148PPI
JCDBG24182JCDBG00306PPI
JCDBG24182JCDBG11027PPI
JCDBG24182JCDBG00558PPI
JCDBG24182JCDBG15810PPI
JCDBG24182JCDBG20457PPI
JCDBG24182JCDBG23734PPI
JCDBG24182JCDBG19936PPI
JCDBG24182JCDBG12398PPI
JCDBG24182JCDBG23113PPI
JCDBG24182JCDBG03587PPI
JCDBG16654JCDBG15890PPI
JCDBG16654JCDBG23530PPI
JCDBG16654JCDBG23880PPI
JCDBG16654JCDBG13802PPI
JCDBG16654JCDBG23469PPI
JCDBG16654JCDBG06148PPI
JCDBG16654JCDBG00306PPI
JCDBG16654JCDBG11027PPI
JCDBG16654JCDBG12398PPI
JCDBG16654JCDBG23113PPI
JCDBG16654JCDBG03587PPI
JCDBG09324JCDBG14958PPI
JCDBG09324JCDBG23880PPI
JCDBG09324JCDBG13802PPI
JCDBG09324JCDBG06148PPI
JCDBG09324JCDBG00306PPI
JCDBG09324JCDBG23113PPI
JCDBG21060JCDBG19729PPI
JCDBG21060JCDBG23880PPI
JCDBG14958JCDBG23880PPI
JCDBG14958JCDBG13802PPI
JCDBG14958JCDBG06148PPI
JCDBG14958JCDBG00306PPI
JCDBG14958JCDBG23113PPI
JCDBG00652JCDBG00306PPI
JCDBG00652JCDBG23113PPI
JCDBG17434JCDBG23530PPI
JCDBG17434JCDBG23880PPI
JCDBG17434JCDBG23469PPI
JCDBG17434JCDBG06148PPI
JCDBG17434JCDBG00306PPI
JCDBG17434JCDBG11027PPI
JCDBG17434JCDBG20457PPI
JCDBG17434JCDBG19936PPI
JCDBG17434JCDBG23113PPI
JCDBG01948JCDBG13802PPI
JCDBG01948JCDBG00306PPI
JCDBG01948JCDBG19936PPI
JCDBG01948JCDBG23113PPI
JCDBG07608JCDBG24974PPI
JCDBG21369JCDBG23530PPI
JCDBG21369JCDBG23880PPI
JCDBG21369JCDBG09074PPI
JCDBG21369JCDBG20457PPI
JCDBG23530JCDBG08740PPI
JCDBG23530JCDBG23880PPI
JCDBG23530JCDBG13802PPI
JCDBG23530JCDBG23469PPI
JCDBG23530JCDBG22653PPI
JCDBG23530JCDBG06148PPI
JCDBG23530JCDBG00306PPI
JCDBG23530JCDBG11027PPI
JCDBG23530JCDBG00558PPI
JCDBG23530JCDBG19936PPI
JCDBG23530JCDBG23113PPI
JCDBG23530JCDBG09698PPI
JCDBG23530JCDBG03587PPI
JCDBG23530JCDBG20354PPI
JCDBG08740JCDBG19929PPI
JCDBG08740JCDBG19936PPI
JCDBG23880JCDBG13802PPI
JCDBG23880JCDBG19929PPI
JCDBG23880JCDBG20140PPI
JCDBG23880JCDBG23997PPI
JCDBG23880JCDBG08746PPI
JCDBG23880JCDBG23469PPI
JCDBG23880JCDBG08044PPI
JCDBG23880JCDBG17129PPI
JCDBG23880JCDBG08468PPI
JCDBG23880JCDBG22653PPI
JCDBG23880JCDBG06148PPI
JCDBG23880JCDBG08991PPI
JCDBG23880JCDBG00558PPI
JCDBG23880JCDBG20457PPI
JCDBG23880JCDBG23734PPI
JCDBG23880JCDBG19936PPI
JCDBG23880JCDBG03587PPI
JCDBG23880JCDBG20354PPI
JCDBG13802JCDBG23997PPI
JCDBG13802JCDBG23469PPI
JCDBG13802JCDBG08468PPI
JCDBG13802JCDBG06148PPI
JCDBG13802JCDBG08991PPI
JCDBG13802JCDBG11027PPI
JCDBG13802JCDBG15810PPI
JCDBG13802JCDBG23734PPI
JCDBG13802JCDBG19936PPI
JCDBG13802JCDBG12398PPI
JCDBG13802JCDBG03587PPI
JCDBG13802JCDBG20354PPI
JCDBG19929JCDBG06148PPI
JCDBG19929JCDBG20354PPI
JCDBG20140JCDBG22653PPI
JCDBG20140JCDBG06148PPI
JCDBG20140JCDBG22121PPI
JCDBG23997JCDBG06148PPI
JCDBG23997JCDBG00306PPI
JCDBG23997JCDBG23113PPI
JCDBG23997JCDBG20354PPI
JCDBG08746JCDBG00306PPI
JCDBG08746JCDBG19936PPI
JCDBG08746JCDBG23113PPI
JCDBG23469JCDBG06148PPI
JCDBG23469JCDBG11027PPI
JCDBG23469JCDBG00558PPI
JCDBG23469JCDBG19936PPI
JCDBG23469JCDBG03587PPI
JCDBG08044JCDBG00306PPI
JCDBG08044JCDBG23734PPI
JCDBG08044JCDBG23113PPI
JCDBG08468JCDBG06148PPI
JCDBG08468JCDBG00306PPI
JCDBG08468JCDBG23113PPI
JCDBG08468JCDBG09698PPI
JCDBG08468JCDBG03587PPI
JCDBG08468JCDBG20354PPI
JCDBG22653JCDBG06148PPI
JCDBG22653JCDBG03587PPI
JCDBG22653JCDBG20354PPI
JCDBG21747JCDBG06148PPI
JCDBG21747JCDBG20457PPI
JCDBG06148JCDBG00306PPI
JCDBG06148JCDBG15810PPI
JCDBG06148JCDBG20457PPI
JCDBG06148JCDBG23734PPI
JCDBG06148JCDBG19936PPI
JCDBG06148JCDBG12398PPI
JCDBG06148JCDBG23113PPI
JCDBG06148JCDBG22121PPI
JCDBG06148JCDBG03587PPI
JCDBG08991JCDBG00306PPI
JCDBG08991JCDBG19936PPI
JCDBG08991JCDBG23113PPI
JCDBG00306JCDBG00558PPI
JCDBG00306JCDBG20457PPI
JCDBG00306JCDBG03587PPI
JCDBG00558JCDBG19936PPI
JCDBG00558JCDBG23113PPI
JCDBG17192JCDBG19936PPI
JCDBG20457JCDBG19936PPI
JCDBG20457JCDBG23113PPI
JCDBG19936JCDBG18629PPI
JCDBG23113JCDBG03587PPI
JCDBG09698JCDBG03587PPI
JCDBR00079
ID
JCDBR00079
Name
rps3
Type
protein_coding
Scaffold
NC_012224.1
Start
90100
End
90765
Strand
-
Exon
90100-90765
Sequence
TATGGGACAAAAAATAAATCCACTTGGTTTCAGACTTGGTACAACTCAAAGTCATCATTCTCTTTGGTTTGCACAACCAA AAAATTATTCTGAGGATCTACAAGAAGATCAAAAAATAAGAAACTGTATCAAAAATTATGTAAAACAAAATACGAAAATA TCTTCTGGTGTTGAGGGAATTGCACGTATAGAGATTCAAAAACGAATCGATGTGATTCAGGTCATGATATATATGGGATT CCAAAAATTATTAATGGAAGGTAGACCTAAACAAATCGAAGAATTACAGATGAATGTACAAAAAGAACTTAATTATGTGA ACCGAAAACTCAATATTGCTATTAAAATTAAAAGAATTTCAAATCCTTATGGGCAACCTAATATTCTTGCAGAATTTATA GCCGGGCAGTTAAAGAATAGAGTTTCATTTCGCAAAGCAATGAAAAAAGCTATTGAATTAACTGAACAAACGGATACAAA AGGAATTCAAGTCCAAATTGCGGGGCGTCTTGACGGAAAAGAAATTGCACGCGTCGAATGGATTAGAGAGGGTAGAGTTC CTTTACAAACCATTCAAGCTAAAATTGAGTATTGTTCGTATACAGTTAAAACTATTTATGGGGTATTAGGCATAAAAATT TGGACATTTCTAGATAAAAAAGAATA
Product
Source
RefSeq
Link:
JCDBP00057
ID
JCDBP00057
Parent
JCDBR00079
Name
YP_002720150.1
Scaffold
NC_012224.1
CDS
90100-90765
Strand:
-
Sequence
MGQKINPLGFRLGTTQSHHSLWFAQPKNYSEDLQEDQKIRNCIKNYVKQNTKISSGVEGIARIEIQKRIDVIQVMIYMGF QKLLMEGRPKQIEELQMNVQKELNYVNRKLNIAIKIKRISNPYGQPNILAEFIAGQLKNRVSFRKAMKKAIELTEQTDTK GIQVQIAGRLDGKEIARVEWIREGRVPLQTIQAKIEYCSYTVKTIYGVLGIKIWTFLDKKE
Product
rps3
Source
RefSeq
Link
YP_002720150.1
InterProScan
IPR001351 Ribosomal protein S3, C-terminal
IPR004044 K Homology domain, type 2
IPR005704 Ribosomal protein S3, bacterial
IPR009019 K homology domain, prokaryotic type
IPR015946 K homology domain-like, alpha/beta
IPR018280 Ribosomal protein S3, conserved site
Pfam
PF00189.16 Ribosomal_S3_C Domain