Detail information of JCDBG00080

JCDBG00080
ID
JCDBG00080
Name
rpl22
Type
protein_coding
Scaffold
NC_012224.1
Start
90862
End
91287
Strand
-
Link
Genbank id:7564773
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0015934 | large ribosomal subunit
Biological process
GO:0006412 | translation
KEGG
Entry: K02890
Name: RP-L22, MRPL22, rplV
Definition: large subunit ribosomal protein L22
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TATGATAAATAAAAGAAAGCGAAAGAGAGACCCATATACGGAAGTATATGCTTTAGGCCAACATATATGTATGTCCGCTC ACAAAGCACGAAGAATAATTGATCAGATTCGTGGACGTTCTTATGAAGAAACACTTATGATACTTGAACTCATGCCCTAT CGAGCATGTTATCCCATTTTTAAATTGATTTATTCTGCAGGAGCAAATGCTAGTCACAATATGGGTTTCAACGAAGCCAA TTTAATCATTAGTAAAGCTGAAGTCAACGAAAGTGCTACTGTGAAAAAATTAAAACCTCAGGCTCGAGGGCGGGGTTATC TGATAAAAAGATCGACTTGTCATATAACTATTGTATTAAAAGATATATCCTTCTATGAAGAATATGAAGAATATGACAAA TATCTAGGAAGAGTATTAAAAATATG
Gene structure

JCDB Genes gff download

JCDBG00080 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00080's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00080JCDBG00082co-exp0.63222
PPI network
node1node2type
JCDBG00080JCDBG15079PPI
JCDBG00080JCDBG21351PPI
JCDBG00080JCDBG01459PPI
JCDBG00080JCDBG16654PPI
JCDBG00080JCDBG09324PPI
JCDBG00080JCDBG17725PPI
JCDBG00080JCDBG14958PPI
JCDBG00080JCDBG17434PPI
JCDBG00080JCDBG21369PPI
JCDBG00080JCDBG12829PPI
JCDBG00080JCDBG23530PPI
JCDBG00080JCDBG19727PPI
JCDBG00080JCDBG05191PPI
JCDBG00080JCDBG18937PPI
JCDBG00080JCDBG23880PPI
JCDBG00080JCDBG19737PPI
JCDBG00080JCDBG23997PPI
JCDBG00080JCDBG20140PPI
JCDBG00080JCDBG19929PPI
JCDBG00080JCDBG24244PPI
JCDBG00080JCDBG09234PPI
JCDBG00080JCDBG23469PPI
JCDBG00080JCDBG25246PPI
JCDBG00080JCDBG17129PPI
JCDBG00080JCDBG13218PPI
JCDBG00080JCDBG15505PPI
JCDBG00080JCDBG02328PPI
JCDBG00080JCDBG08468PPI
JCDBG00080JCDBG12807PPI
JCDBG00080JCDBG18040PPI
JCDBG00080JCDBG22653PPI
JCDBG00080JCDBG21747PPI
JCDBG00080JCDBG15810PPI
JCDBG00080JCDBG13807PPI
JCDBG00080JCDBG08795PPI
JCDBG00080JCDBG20457PPI
JCDBG00080JCDBG23734PPI
JCDBG00080JCDBG12398PPI
JCDBG00080JCDBG06075PPI
JCDBG00080JCDBG22121PPI
JCDBG00080JCDBG08310PPI
JCDBG00080JCDBG17585PPI
JCDBG00080JCDBG03587PPI
JCDBG00080JCDBG22117PPI
JCDBG15079JCDBG23880PPI
JCDBG21351JCDBG16654PPI
JCDBG21351JCDBG23530PPI
JCDBG21351JCDBG19737PPI
JCDBG21351JCDBG23469PPI
JCDBG21351JCDBG17129PPI
JCDBG21351JCDBG15505PPI
JCDBG16654JCDBG23530PPI
JCDBG16654JCDBG23880PPI
JCDBG16654JCDBG09234PPI
JCDBG16654JCDBG23469PPI
JCDBG16654JCDBG12398PPI
JCDBG16654JCDBG03587PPI
JCDBG09324JCDBG14958PPI
JCDBG09324JCDBG23880PPI
JCDBG14958JCDBG23880PPI
JCDBG17434JCDBG23530PPI
JCDBG17434JCDBG23880PPI
JCDBG17434JCDBG19737PPI
JCDBG17434JCDBG23469PPI
JCDBG17434JCDBG20457PPI
JCDBG17434JCDBG06075PPI
JCDBG21369JCDBG23530PPI
JCDBG21369JCDBG23880PPI
JCDBG21369JCDBG09234PPI
JCDBG21369JCDBG20457PPI
JCDBG21369JCDBG17585PPI
JCDBG12829JCDBG23997PPI
JCDBG12829JCDBG06075PPI
JCDBG23530JCDBG23880PPI
JCDBG23530JCDBG19737PPI
JCDBG23530JCDBG09234PPI
JCDBG23530JCDBG23469PPI
JCDBG23530JCDBG18040PPI
JCDBG23530JCDBG22653PPI
JCDBG23530JCDBG03587PPI
JCDBG19727JCDBG09234PPI
JCDBG05191JCDBG23880PPI
JCDBG05191JCDBG22121PPI
JCDBG23880JCDBG23997PPI
JCDBG23880JCDBG20140PPI
JCDBG23880JCDBG19929PPI
JCDBG23880JCDBG23469PPI
JCDBG23880JCDBG25246PPI
JCDBG23880JCDBG17129PPI
JCDBG23880JCDBG15505PPI
JCDBG23880JCDBG08468PPI
JCDBG23880JCDBG18040PPI
JCDBG23880JCDBG22653PPI
JCDBG23880JCDBG20457PPI
JCDBG23880JCDBG23734PPI
JCDBG23880JCDBG08310PPI
JCDBG23880JCDBG17585PPI
JCDBG23880JCDBG03587PPI
JCDBG19737JCDBG23997PPI
JCDBG19737JCDBG20140PPI
JCDBG19737JCDBG02328PPI
JCDBG19737JCDBG20457PPI
JCDBG19737JCDBG06075PPI
JCDBG19737JCDBG17585PPI
JCDBG23997JCDBG09234PPI
JCDBG23997JCDBG06075PPI
JCDBG20140JCDBG22653PPI
JCDBG20140JCDBG22121PPI
JCDBG19929JCDBG09234PPI
JCDBG19929JCDBG17585PPI
JCDBG09234JCDBG20457PPI
JCDBG23469JCDBG06075PPI
JCDBG23469JCDBG17585PPI
JCDBG23469JCDBG03587PPI
JCDBG17129JCDBG06075PPI
JCDBG13218JCDBG18040PPI
JCDBG08468JCDBG06075PPI
JCDBG08468JCDBG17585PPI
JCDBG08468JCDBG03587PPI
JCDBG12807JCDBG06075PPI
JCDBG22653JCDBG06075PPI
JCDBG22653JCDBG03587PPI
JCDBG21747JCDBG20457PPI
JCDBG12398JCDBG08310PPI
JCDBG06075JCDBG03587PPI
JCDBG22121JCDBG08310PPI
JCDBG08310JCDBG17585PPI
JCDBR00080
ID
JCDBR00080
Name
rpl22
Type
protein_coding
Scaffold
NC_012224.1
Start
90862
End
91287
Strand
-
Exon
90862-91287
Sequence
TATGATAAATAAAAGAAAGCGAAAGAGAGACCCATATACGGAAGTATATGCTTTAGGCCAACATATATGTATGTCCGCTC ACAAAGCACGAAGAATAATTGATCAGATTCGTGGACGTTCTTATGAAGAAACACTTATGATACTTGAACTCATGCCCTAT CGAGCATGTTATCCCATTTTTAAATTGATTTATTCTGCAGGAGCAAATGCTAGTCACAATATGGGTTTCAACGAAGCCAA TTTAATCATTAGTAAAGCTGAAGTCAACGAAAGTGCTACTGTGAAAAAATTAAAACCTCAGGCTCGAGGGCGGGGTTATC TGATAAAAAGATCGACTTGTCATATAACTATTGTATTAAAAGATATATCCTTCTATGAAGAATATGAAGAATATGACAAA TATCTAGGAAGAGTATTAAAAATATG
Product
Source
RefSeq
Link:
JCDBP00058
ID
JCDBP00058
Parent
JCDBR00080
Name
YP_002720151.1
Scaffold
NC_012224.1
CDS
90862-91287
Strand:
-
Sequence
MINKRKRKRDPYTEVYALGQHICMSAHKARRIIDQIRGRSYEETLMILELMPYRACYPIFKLIYSAGANASHNMGFNEAN LIISKAEVNESATVKKLKPQARGRGYLIKRSTCHITIVLKDISFYEEYEEYDKYLGRVLKI
Product
ribosomal protein L22
Source
RefSeq
Link
YP_002720151.1
InterProScan
IPR001063 Ribosomal protein L22/L17
IPR005727 Ribosomal protein L22, bacterial/chloroplast-type
Pfam
PF00237.15 Ribosomal_L22 Domain