Detail information of JCDBG00081

JCDBG00081
ID
JCDBG00081
Name
rps19
Type
protein_coding
Scaffold
NC_012224.1
Start
91383
End
91661
Strand
-
Link
Genbank id:7564774
Molecular function
GO:0003723 | RNA binding
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0015935 | small ribosomal subunit
Biological process
GO:0006412 | translation
KEGG
Entry: K02965
Name: RP-S19, rpsS
Definition: small subunit ribosomal protein S19
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TGTGACACGTTCACTAAAAAAAAACCCTTTTGTAGCAAATCATTTATTAAAAAAAATAAATAAGCTTAACACAAAAGCAG AAAAAGAAATAATAGCAACGTGGTCCCGGGCATCTACCATTATACCCACAATGATCGGCCATACTATTGCTATCCATAAT GGAAAGGGGCATTTACCTATTTATATAACGGATCGCATGGTGGGCCATAAATTGGGAGAATTTTCACCTACTTTAAATTT CCGGGAACATGCAAAAAATGATAATAAATCTCGTCGTTA
Gene structure

JCDB Genes gff download

JCDBG00081 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00081's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00081JCDBG00082co-exp0.716371
JCDBG00081JCDBG00089co-exp0.647066
JCDBG00081JCDBG00130co-exp0.612434
JCDBG00081JCDBG00062co-exp0.605239
JCDBG00081JCDBG06704co-exp0.603462
JCDBG00081JCDBG16110co-exp0.601643
JCDBG00082JCDBG00130co-exp0.743639
JCDBG00082JCDBG00062co-exp0.737603
JCDBG00082JCDBG06704co-exp0.698718
JCDBG00082JCDBG16110co-exp0.690624
JCDBG00130JCDBG00062co-exp0.660332
JCDBG00130JCDBG16110co-exp0.608044
JCDBG00062JCDBG06704co-exp0.847745
JCDBG00062JCDBG16110co-exp0.887449
JCDBG06704JCDBG16110co-exp0.911961
PPI network
node1node2type
JCDBG00081JCDBG24182PPI
JCDBG00081JCDBG23530PPI
JCDBG00081JCDBG20369PPI
JCDBG00081JCDBG03794PPI
JCDBG00081JCDBG08468PPI
JCDBG00081JCDBG00306PPI
JCDBG00081JCDBG11027PPI
JCDBG00081JCDBG23113PPI
JCDBG24182JCDBG23530PPI
JCDBG24182JCDBG03794PPI
JCDBG24182JCDBG08468PPI
JCDBG24182JCDBG00306PPI
JCDBG24182JCDBG11027PPI
JCDBG24182JCDBG23113PPI
JCDBG23530JCDBG03794PPI
JCDBG23530JCDBG00306PPI
JCDBG23530JCDBG11027PPI
JCDBG23530JCDBG23113PPI
JCDBG20369JCDBG00306PPI
JCDBG20369JCDBG23113PPI
JCDBG08468JCDBG00306PPI
JCDBG08468JCDBG23113PPI
JCDBR00081
ID
JCDBR00081
Name
rps19
Type
protein_coding
Scaffold
NC_012224.1
Start
91383
End
91661
Strand
-
Exon
91383-91661
Sequence
TGTGACACGTTCACTAAAAAAAAACCCTTTTGTAGCAAATCATTTATTAAAAAAAATAAATAAGCTTAACACAAAAGCAG AAAAAGAAATAATAGCAACGTGGTCCCGGGCATCTACCATTATACCCACAATGATCGGCCATACTATTGCTATCCATAAT GGAAAGGGGCATTTACCTATTTATATAACGGATCGCATGGTGGGCCATAAATTGGGAGAATTTTCACCTACTTTAAATTT CCGGGAACATGCAAAAAATGATAATAAATCTCGTCGTTA
Product
Source
RefSeq
Link:
JCDBP00059
ID
JCDBP00059
Parent
JCDBR00081
Name
YP_002720152.1
Scaffold
NC_012224.1
CDS
91383-91661
Strand:
-
Sequence
MTRSLKKNPFVANHLLKKINKLNTKAEKEIIATWSRASTIIPTMIGHTIAIHNGKGHLPIYITDRMVGHKLGEFSPTLNF REHAKNDNKSRR
Product
rps19
Source
RefSeq
Link
YP_002720152.1
InterProScan
IPR002222 Ribosomal protein S19/S15
IPR005732 Ribosomal protein S19, bacterial-type
IPR020934 Ribosomal protein S19 conserved site
IPR023575 Ribosomal protein S19, superfamily
Pfam
PF00203.17 Ribosomal_S19 Domain