Detail information of JCDBG00082

JCDBG00082
ID
JCDBG00082
Name
rpl2
Type
protein_coding
Scaffold
NC_012224.1
Start
91732
End
93224
Strand
-
Link
Genbank id:7564775 | Jatropha Genome Database ID:Jcr4U33242.10
Molecular function
GO:0003723 | RNA binding
GO:0016740 | transferase activity
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0015934 | large ribosomal subunit
GO:0005622 | intracellular
Biological process
GO:0006412 | translation
KEGG
Entry: K02886
Name: RP-L2, MRPL2, rplB
Definition: large subunit ribosomal protein L2
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
CATGGCGATACATTTATACAAAACTTCTACCCCGAGCACACGCAATGGAGCCGTAGACAGTCAAGTGAAATCCAATACAC GAAATAATTTGATCTATGGACAGCATCGTTGTGGTAAAGGACGTAATGCCAGAGGAATCATTACCGCAAGGCATAGAGGG GGGGGTCATAAGCGTCTATACCGTAAAATCGATTTTCGACGGAATGAAAAAGACATATATGGTAGAATCGTAACCATAGA ATACGACCCTAATCGAAATGCATACATTTGTCTCATACACTATGGGGATGGTGAGAAGAGATATATTTTACATCCCAGAG GGGCTATAATTGGAGATACCATTATTTCTGGTACAGAAGTTCCTATAAAAATGGGAAATGCCCTACCTTTGAGTGCGGTT TGAACTATTGATTTACGTAATTGGAAGTAACCAATTAGGTTTACGACGAAACCTAGAAATCGATCACTGATCCAATTTGA GTACCTCTACAGGATAGACCTCAACAGAAAACTGAAGAGTAACGGCAGCAAGTGATTGAGTTCAGTAGTTCCTCATAGAA AATTATTGACTCTAGAGATATAGTAATATGGAGAAGACAAAATTGTTTCAAGCACCGACAGAACCAGAAGCGCCCCTTGT TTCAAAGAGAGGAGGACGGGTTATTCACATTTCATTTGATGGTCAGAGGCGAATTGAAAGCTAAGCAGTGGTAATTCTAA AGATTCCCCGGGGGAAAAATAGAAATGTCTCCTACGTTACCCCTAATATGTGGAAGTATCGACGTAATTTCATAGAGTCA TTCGGTCTGAATGCTACATGAAGAACATAAGCCAGATGAAGGAACGGGAAGACCTAGGATGTAGAAGAGCATAACATGAG TGATTCAGCAGATTTGGATTCCTATATATCCACTCATGTAGTACTTTATTTCATTTTACGATATATAAGATCCATCTGTA TAGATATCATCATCTACACCCAGAAAGCCGTATGCTTTGGAAGAAGCTTGTACAGTTTGGGAAGAGGTTTTGATTGATCA AAAAGAAGAATCTACTTCAACCGATATGCCCTTAGGCACGGCCATACATAACATAGAAATCACACTTGGAAAGGGTGGAC AATTAGCTAGAGCTGCAGGTGCTGTAGCGAAACTGATTGCAAAAGAGGGGAAATCGGCCACATTAAAATTACCTTCTGGG GAGGTTCGTTTAATATCCAAAAACTGCTCAGCAACAGTCGGACAAGTAGGCAATACTGGGGTGAACCAGAAAAGTTTGGG TAGAGCCGGATCTAAATGTTGGCTAGGTAAGCGTCCTGTAGTAAGAGGAGTAGTTATGAACCCTGTAGACCATCCCCATG GGGGTGGTGAAGGGAGGGCCCCAATTGGTAGAAAAAAACCCGCAACCCCTTGGGGGTATCCTGCACTTGGAAGAAGAAGT AGAAAAAGGAATAAATATAGTGATAATTTGATTCTTCGTCGCCGTACTAAGTA
Gene structure

JCDB Genes gff download

JCDBG00082 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00082's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00082JCDBG00037co-exp0.753482
JCDBG00082JCDBG00130co-exp0.743639
JCDBG00082JCDBG00012co-exp0.741257
JCDBG00082JCDBG00065co-exp0.740753
JCDBG00082JCDBG00062co-exp0.737603
JCDBG00082JCDBG00112co-exp0.725469
JCDBG00082JCDBG00046co-exp0.725285
JCDBG00082JCDBG00081co-exp0.716371
JCDBG00082JCDBG00041co-exp0.712608
JCDBG00082JCDBG25085co-exp0.711335
JCDBG00037JCDBG00130co-exp0.712007
JCDBG00037JCDBG00012co-exp0.963833
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00037JCDBG00062co-exp0.934869
JCDBG00037JCDBG00112co-exp0.958141
JCDBG00037JCDBG00046co-exp0.956923
JCDBG00037JCDBG00041co-exp0.807298
JCDBG00037JCDBG25085co-exp0.877054
JCDBG00130JCDBG00012co-exp0.69428
JCDBG00130JCDBG00065co-exp0.666217
JCDBG00130JCDBG00062co-exp0.660332
JCDBG00130JCDBG00112co-exp0.694125
JCDBG00130JCDBG00046co-exp0.657998
JCDBG00130JCDBG00081co-exp0.612434
JCDBG00130JCDBG00041co-exp0.645555
JCDBG00130JCDBG25085co-exp0.625852
JCDBG00012JCDBG00065co-exp0.946607
JCDBG00012JCDBG00062co-exp0.910668
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG00046co-exp0.949104
JCDBG00012JCDBG00041co-exp0.854468
JCDBG00012JCDBG25085co-exp0.850285
JCDBG00065JCDBG00062co-exp0.946062
JCDBG00065JCDBG00112co-exp0.944148
JCDBG00065JCDBG00046co-exp0.954196
JCDBG00065JCDBG00041co-exp0.791634
JCDBG00065JCDBG25085co-exp0.875913
JCDBG00062JCDBG00112co-exp0.902815
JCDBG00062JCDBG00046co-exp0.908979
JCDBG00062JCDBG00081co-exp0.605239
JCDBG00062JCDBG00041co-exp0.757696
JCDBG00062JCDBG25085co-exp0.847115
JCDBG00112JCDBG00046co-exp0.924872
JCDBG00112JCDBG00041co-exp0.811234
JCDBG00112JCDBG25085co-exp0.846666
JCDBG00046JCDBG00041co-exp0.816192
JCDBG00046JCDBG25085co-exp0.862595
JCDBG00041JCDBG25085co-exp0.660711
PPI network
node1node2type
JCDBG00082JCDBG24182PPI
JCDBG00082JCDBG16654PPI
JCDBG00082JCDBG15890PPI
JCDBG00082JCDBG01015PPI
JCDBG00082JCDBG00652PPI
JCDBG00082JCDBG17434PPI
JCDBG00082JCDBG00952PPI
JCDBG00082JCDBG21369PPI
JCDBG00082JCDBG01948PPI
JCDBG00082JCDBG03004PPI
JCDBG00082JCDBG23530PPI
JCDBG00082JCDBG05304PPI
JCDBG00082JCDBG03672PPI
JCDBG00082JCDBG05767PPI
JCDBG00082JCDBG09043PPI
JCDBG00082JCDBG17444PPI
JCDBG00082JCDBG15442PPI
JCDBG00082JCDBG12505PPI
JCDBG00082JCDBG08740PPI
JCDBG00082JCDBG23370PPI
JCDBG00082JCDBG09385PPI
JCDBG00082JCDBG06183PPI
JCDBG00082JCDBG18937PPI
JCDBG00082JCDBG23880PPI
JCDBG00082JCDBG15243PPI
JCDBG00082JCDBG13802PPI
JCDBG00082JCDBG23384PPI
JCDBG00082JCDBG19929PPI
JCDBG00082JCDBG20140PPI
JCDBG00082JCDBG23997PPI
JCDBG00082JCDBG07554PPI
JCDBG00082JCDBG01882PPI
JCDBG00082JCDBG09118PPI
JCDBG00082JCDBG03888PPI
JCDBG00082JCDBG18267PPI
JCDBG00082JCDBG13210PPI
JCDBG00082JCDBG23469PPI
JCDBG00082JCDBG20473PPI
JCDBG00082JCDBG03629PPI
JCDBG00082JCDBG12248PPI
JCDBG00082JCDBG09892PPI
JCDBG00082JCDBG04887PPI
JCDBG00082JCDBG03801PPI
JCDBG00082JCDBG23088PPI
JCDBG00082JCDBG13649PPI
JCDBG00082JCDBG24155PPI
JCDBG00082JCDBG12997PPI
JCDBG00082JCDBG01626PPI
JCDBG00082JCDBG22919PPI
JCDBG00082JCDBG17129PPI
JCDBG00082JCDBG05999PPI
JCDBG00082JCDBG08013PPI
JCDBG00082JCDBG08163PPI
JCDBG00082JCDBG08468PPI
JCDBG00082JCDBG12459PPI
JCDBG00082JCDBG22653PPI
JCDBG00082JCDBG06148PPI
JCDBG00082JCDBG21747PPI
JCDBG00082JCDBG08991PPI
JCDBG00082JCDBG00306PPI
JCDBG00082JCDBG00558PPI
JCDBG00082JCDBG00951PPI
JCDBG00082JCDBG07506PPI
JCDBG00082JCDBG17192PPI
JCDBG00082JCDBG15984PPI
JCDBG00082JCDBG02034PPI
JCDBG00082JCDBG00944PPI
JCDBG00082JCDBG05206PPI
JCDBG00082JCDBG19652PPI
JCDBG00082JCDBG03555PPI
JCDBG00082JCDBG08199PPI
JCDBG00082JCDBG04508PPI
JCDBG00082JCDBG17544PPI
JCDBG00082JCDBG14338PPI
JCDBG00082JCDBG12692PPI
JCDBG00082JCDBG20457PPI
JCDBG00082JCDBG19936PPI
JCDBG00082JCDBG20000PPI
JCDBG00082JCDBG20749PPI
JCDBG00082JCDBG18629PPI
JCDBG00082JCDBG12398PPI
JCDBG00082JCDBG16005PPI
JCDBG00082JCDBG23113PPI
JCDBG00082JCDBG06075PPI
JCDBG00082JCDBG09698PPI
JCDBG00082JCDBG18419PPI
JCDBG00082JCDBG20116PPI
JCDBG00082JCDBG02680PPI
JCDBG00082JCDBG17483PPI
JCDBG00082JCDBG16997PPI
JCDBG00082JCDBG10763PPI
JCDBG00082JCDBG10516PPI
JCDBG00082JCDBG08310PPI
JCDBG00082JCDBG03587PPI
JCDBG00082JCDBG20354PPI
JCDBG00082JCDBG05180PPI
JCDBG24182JCDBG16654PPI
JCDBG24182JCDBG17434PPI
JCDBG24182JCDBG21369PPI
JCDBG24182JCDBG23530PPI
JCDBG24182JCDBG12505PPI
JCDBG24182JCDBG23880PPI
JCDBG24182JCDBG13802PPI
JCDBG24182JCDBG19929PPI
JCDBG24182JCDBG20140PPI
JCDBG24182JCDBG23997PPI
JCDBG24182JCDBG23469PPI
JCDBG24182JCDBG20473PPI
JCDBG24182JCDBG17129PPI
JCDBG24182JCDBG08468PPI
JCDBG24182JCDBG22653PPI
JCDBG24182JCDBG06148PPI
JCDBG24182JCDBG21747PPI
JCDBG24182JCDBG00306PPI
JCDBG24182JCDBG00558PPI
JCDBG24182JCDBG07506PPI
JCDBG24182JCDBG20457PPI
JCDBG24182JCDBG19936PPI
JCDBG24182JCDBG12398PPI
JCDBG24182JCDBG16005PPI
JCDBG24182JCDBG23113PPI
JCDBG24182JCDBG18419PPI
JCDBG24182JCDBG02680PPI
JCDBG24182JCDBG03587PPI
JCDBG16654JCDBG15890PPI
JCDBG16654JCDBG03004PPI
JCDBG16654JCDBG23530PPI
JCDBG16654JCDBG23880PPI
JCDBG16654JCDBG15243PPI
JCDBG16654JCDBG13802PPI
JCDBG16654JCDBG23469PPI
JCDBG16654JCDBG20473PPI
JCDBG16654JCDBG08163PPI
JCDBG16654JCDBG06148PPI
JCDBG16654JCDBG00306PPI
JCDBG16654JCDBG07506PPI
JCDBG16654JCDBG12398PPI
JCDBG16654JCDBG23113PPI
JCDBG16654JCDBG18419PPI
JCDBG16654JCDBG03587PPI
JCDBG15890JCDBG03004PPI
JCDBG15890JCDBG18937PPI
JCDBG15890JCDBG08199PPI
JCDBG01015JCDBG19936PPI
JCDBG01015JCDBG06075PPI
JCDBG00652JCDBG00306PPI
JCDBG00652JCDBG23113PPI
JCDBG17434JCDBG03004PPI
JCDBG17434JCDBG23530PPI
JCDBG17434JCDBG23880PPI
JCDBG17434JCDBG23469PPI
JCDBG17434JCDBG20473PPI
JCDBG17434JCDBG06148PPI
JCDBG17434JCDBG00306PPI
JCDBG17434JCDBG07506PPI
JCDBG17434JCDBG20457PPI
JCDBG17434JCDBG19936PPI
JCDBG17434JCDBG23113PPI
JCDBG17434JCDBG06075PPI
JCDBG17434JCDBG18419PPI
JCDBG00952JCDBG23088PPI
JCDBG00952JCDBG00951PPI
JCDBG21369JCDBG23530PPI
JCDBG21369JCDBG23880PPI
JCDBG21369JCDBG20457PPI
JCDBG01948JCDBG13802PPI
JCDBG01948JCDBG00306PPI
JCDBG01948JCDBG19936PPI
JCDBG01948JCDBG23113PPI
JCDBG03004JCDBG23530PPI
JCDBG03004JCDBG19929PPI
JCDBG03004JCDBG20140PPI
JCDBG03004JCDBG23997PPI
JCDBG03004JCDBG01882PPI
JCDBG03004JCDBG23469PPI
JCDBG03004JCDBG08468PPI
JCDBG03004JCDBG22653PPI
JCDBG03004JCDBG06148PPI
JCDBG03004JCDBG20457PPI
JCDBG03004JCDBG03587PPI
JCDBG23530JCDBG08740PPI
JCDBG23530JCDBG23880PPI
JCDBG23530JCDBG13802PPI
JCDBG23530JCDBG23469PPI
JCDBG23530JCDBG20473PPI
JCDBG23530JCDBG04887PPI
JCDBG23530JCDBG22653PPI
JCDBG23530JCDBG06148PPI
JCDBG23530JCDBG00306PPI
JCDBG23530JCDBG00558PPI
JCDBG23530JCDBG07506PPI
JCDBG23530JCDBG19936PPI
JCDBG23530JCDBG23113PPI
JCDBG23530JCDBG09698PPI
JCDBG23530JCDBG18419PPI
JCDBG23530JCDBG20116PPI
JCDBG23530JCDBG03587PPI
JCDBG23530JCDBG20354PPI
JCDBG05304JCDBG15243PPI
JCDBG05304JCDBG13802PPI
JCDBG05304JCDBG17129PPI
JCDBG15442JCDBG23370PPI
JCDBG15442JCDBG07554PPI
JCDBG15442JCDBG04887PPI
JCDBG15442JCDBG03801PPI
JCDBG15442JCDBG12997PPI
JCDBG15442JCDBG10763PPI
JCDBG12505JCDBG23088PPI
JCDBG08740JCDBG19929PPI
JCDBG08740JCDBG19936PPI
JCDBG08740JCDBG06075PPI
JCDBG08740JCDBG20116PPI
JCDBG23370JCDBG07554PPI
JCDBG23370JCDBG04887PPI
JCDBG23370JCDBG03801PPI
JCDBG23370JCDBG12997PPI
JCDBG23370JCDBG10763PPI
JCDBG09385JCDBG19929PPI
JCDBG06183JCDBG10516PPI
JCDBG18937JCDBG23088PPI
JCDBG18937JCDBG06148PPI
JCDBG18937JCDBG07506PPI
JCDBG18937JCDBG18419PPI
JCDBG23880JCDBG15243PPI
JCDBG23880JCDBG13802PPI
JCDBG23880JCDBG19929PPI
JCDBG23880JCDBG20140PPI
JCDBG23880JCDBG23997PPI
JCDBG23880JCDBG23469PPI
JCDBG23880JCDBG17129PPI
JCDBG23880JCDBG08163PPI
JCDBG23880JCDBG08468PPI
JCDBG23880JCDBG22653PPI
JCDBG23880JCDBG06148PPI
JCDBG23880JCDBG08991PPI
JCDBG23880JCDBG00558PPI
JCDBG23880JCDBG07506PPI
JCDBG23880JCDBG20457PPI
JCDBG23880JCDBG19936PPI
JCDBG23880JCDBG20749PPI
JCDBG23880JCDBG20116PPI
JCDBG23880JCDBG08310PPI
JCDBG23880JCDBG03587PPI
JCDBG23880JCDBG20354PPI
JCDBG15243JCDBG23469PPI
JCDBG15243JCDBG00306PPI
JCDBG15243JCDBG07506PPI
JCDBG15243JCDBG23113PPI
JCDBG15243JCDBG18419PPI
JCDBG15243JCDBG08310PPI
JCDBG13802JCDBG23997PPI
JCDBG13802JCDBG23469PPI
JCDBG13802JCDBG08468PPI
JCDBG13802JCDBG06148PPI
JCDBG13802JCDBG08991PPI
JCDBG13802JCDBG19936PPI
JCDBG13802JCDBG12398PPI
JCDBG13802JCDBG02680PPI
JCDBG13802JCDBG03587PPI
JCDBG13802JCDBG20354PPI
JCDBG19929JCDBG20473PPI
JCDBG19929JCDBG06148PPI
JCDBG19929JCDBG07506PPI
JCDBG19929JCDBG18419PPI
JCDBG19929JCDBG20354PPI
JCDBG20140JCDBG22653PPI
JCDBG20140JCDBG06148PPI
JCDBG20140JCDBG07506PPI
JCDBG20140JCDBG18419PPI
JCDBG20140JCDBG20116PPI
JCDBG23997JCDBG20473PPI
JCDBG23997JCDBG06148PPI
JCDBG23997JCDBG00306PPI
JCDBG23997JCDBG07506PPI
JCDBG23997JCDBG23113PPI
JCDBG23997JCDBG06075PPI
JCDBG23997JCDBG20354PPI
JCDBG07554JCDBG04887PPI
JCDBG07554JCDBG03801PPI
JCDBG07554JCDBG12997PPI
JCDBG07554JCDBG10763PPI
JCDBG01882JCDBG19936PPI
JCDBG09118JCDBG19936PPI
JCDBG09118JCDBG06075PPI
JCDBG09118JCDBG20116PPI
JCDBG03888JCDBG04508PPI
JCDBG13210JCDBG08468PPI
JCDBG23469JCDBG20473PPI
JCDBG23469JCDBG06148PPI
JCDBG23469JCDBG00558PPI
JCDBG23469JCDBG07506PPI
JCDBG23469JCDBG14338PPI
JCDBG23469JCDBG19936PPI
JCDBG23469JCDBG06075PPI
JCDBG23469JCDBG18419PPI
JCDBG23469JCDBG20116PPI
JCDBG23469JCDBG03587PPI
JCDBG20473JCDBG00558PPI
JCDBG20473JCDBG20457PPI
JCDBG03629JCDBG16005PPI
JCDBG03629JCDBG20116PPI
JCDBG12248JCDBG08310PPI
JCDBG09892JCDBG04887PPI
JCDBG09892JCDBG03801PPI
JCDBG09892JCDBG12997PPI
JCDBG04887JCDBG03801PPI
JCDBG04887JCDBG12997PPI
JCDBG04887JCDBG10763PPI
JCDBG03801JCDBG12997PPI
JCDBG03801JCDBG10763PPI
JCDBG23088JCDBG24155PPI
JCDBG23088JCDBG12997PPI
JCDBG23088JCDBG00951PPI
JCDBG23088JCDBG20000PPI
JCDBG23088JCDBG16005PPI
JCDBG24155JCDBG06075PPI
JCDBG12997JCDBG00944PPI
JCDBG12997JCDBG10763PPI
JCDBG17129JCDBG06075PPI
JCDBG17129JCDBG18419PPI
JCDBG08013JCDBG00306PPI
JCDBG08013JCDBG23113PPI
JCDBG08163JCDBG00306PPI
JCDBG08163JCDBG07506PPI
JCDBG08163JCDBG19936PPI
JCDBG08163JCDBG12398PPI
JCDBG08163JCDBG23113PPI
JCDBG08468JCDBG06148PPI
JCDBG08468JCDBG00306PPI
JCDBG08468JCDBG07506PPI
JCDBG08468JCDBG23113PPI
JCDBG08468JCDBG06075PPI
JCDBG08468JCDBG09698PPI
JCDBG08468JCDBG18419PPI
JCDBG08468JCDBG03587PPI
JCDBG08468JCDBG20354PPI
JCDBG22653JCDBG06148PPI
JCDBG22653JCDBG07506PPI
JCDBG22653JCDBG05206PPI
JCDBG22653JCDBG06075PPI
JCDBG22653JCDBG03587PPI
JCDBG22653JCDBG20354PPI
JCDBG06148JCDBG21747PPI
JCDBG06148JCDBG00306PPI
JCDBG06148JCDBG07506PPI
JCDBG06148JCDBG20457PPI
JCDBG06148JCDBG19936PPI
JCDBG06148JCDBG12398PPI
JCDBG06148JCDBG23113PPI
JCDBG06148JCDBG06075PPI
JCDBG06148JCDBG03587PPI
JCDBG21747JCDBG07506PPI
JCDBG21747JCDBG20457PPI
JCDBG08991JCDBG00306PPI
JCDBG08991JCDBG19936PPI
JCDBG08991JCDBG23113PPI
JCDBG08991JCDBG08310PPI
JCDBG00306JCDBG00558PPI
JCDBG00306JCDBG19652PPI
JCDBG00306JCDBG12692PPI
JCDBG00306JCDBG20457PPI
JCDBG00306JCDBG06075PPI
JCDBG00306JCDBG18419PPI
JCDBG00306JCDBG02680PPI
JCDBG00306JCDBG03587PPI
JCDBG00558JCDBG07506PPI
JCDBG00558JCDBG19936PPI
JCDBG00558JCDBG23113PPI
JCDBG00558JCDBG06075PPI
JCDBG07506JCDBG20457PPI
JCDBG07506JCDBG19936PPI
JCDBG07506JCDBG20749PPI
JCDBG07506JCDBG12398PPI
JCDBG07506JCDBG08310PPI
JCDBG07506JCDBG03587PPI
JCDBG17192JCDBG19936PPI
JCDBG19652JCDBG19936PPI
JCDBG19652JCDBG23113PPI
JCDBG14338JCDBG16005PPI
JCDBG12692JCDBG19936PPI
JCDBG12692JCDBG23113PPI
JCDBG12692JCDBG06075PPI
JCDBG12692JCDBG18419PPI
JCDBG12692JCDBG17483PPI
JCDBG20457JCDBG19936PPI
JCDBG20457JCDBG23113PPI
JCDBG19936JCDBG18629PPI
JCDBG19936JCDBG18419PPI
JCDBG19936JCDBG02680PPI
JCDBG20749JCDBG02680PPI
JCDBG12398JCDBG08310PPI
JCDBG23113JCDBG06075PPI
JCDBG23113JCDBG18419PPI
JCDBG23113JCDBG02680PPI
JCDBG23113JCDBG03587PPI
JCDBG06075JCDBG20116PPI
JCDBG06075JCDBG03587PPI
JCDBG09698JCDBG03587PPI
JCDBG18419JCDBG03587PPI
JCDBG20116JCDBG17483PPI
JCDBG20116JCDBG03587PPI
JCDBR00082
ID
JCDBR00082
Name
rpl2
Type
protein_coding
Scaffold
NC_012224.1
Start
91732
End
93224
Strand
-
Exon
91732-92202,92832-93224
Sequence
CATGGCGATACATTTATACAAAACTTCTACCCCGAGCACACGCAATGGAGCCGTAGACAGTCAAGTGAAATCCAATACAC GAAATAATTTGATCTATGGACAGCATCGTTGTGGTAAAGGACGTAATGCCAGAGGAATCATTACCGCAAGGCATAGAGGG GGGGGTCATAAGCGTCTATACCGTAAAATCGATTTTCGACGGAATGAAAAAGACATATATGGTAGAATCGTAACCATAGA ATACGACCCTAATCGAAATGCATACATTTGTCTCATACACTATGGGGATGGTGAGAAGAGATATATTTTACATCCCAGAG GGGCTATAATTGGAGATACCATTATTTCTGGTACAGAAGTTCCTATAAAAATGGGAAATGCCCTACCTTTGAGTGCGGTT TGAACTATTGATTTACGTAATTGGAAGTAACCAATTAGGTTTACGACGAAACCTAGAAATCGATCACTGATCCAATTTGA GTACCTCTACAGGATAGACCTCAACAGAAAACTGAAGAGTAACGGCAGCAAGTGATTGAGTTCAGTAGTTCCTCATAGAA AATTATTGACTCTAGAGATATAGTAATATGGAGAAGACAAAATTGTTTCAAGCACCGACAGAACCAGAAGCGCCCCTTGT TTCAAAGAGAGGAGGACGGGTTATTCACATTTCATTTGATGGTCAGAGGCGAATTGAAAGCTAAGCAGTGGTAATTCTAA AGATTCCCCGGGGGAAAAATAGAAATGTCTCCTACGTTACCCCTAATATGTGGAAGTATCGACGTAATTTCATAGAGTCA TTCGGTCTGAATGCTACATGAAGAACATAAGCCAGATGAAGGAACGGGAAGACCTAGGATGTAGAAGAGCATAACATGAG TGATTCAGCAGATTTGGATTCCTATATATCCACTCATGTAGTACTTTATTTCATTTTACGATATATAAGATCCATCTGTA TAGATATCATCATCTACACCCAGAAAGCCGTATGCTTTGGAAGAAGCTTGTACAGTTTGGGAAGAGGTTTTGATTGATCA AAAAGAAGAATCTACTTCAACCGATATGCCCTTAGGCACGGCCATACATAACATAGAAATCACACTTGGAAAGGGTGGAC AATTAGCTAGAGCTGCAGGTGCTGTAGCGAAACTGATTGCAAAAGAGGGGAAATCGGCCACATTAAAATTACCTTCTGGG GAGGTTCGTTTAATATCCAAAAACTGCTCAGCAACAGTCGGACAAGTAGGCAATACTGGGGTGAACCAGAAAAGTTTGGG TAGAGCCGGATCTAAATGTTGGCTAGGTAAGCGTCCTGTAGTAAGAGGAGTAGTTATGAACCCTGTAGACCATCCCCATG GGGGTGGTGAAGGGAGGGCCCCAATTGGTAGAAAAAAACCCGCAACCCCTTGGGGGTATCCTGCACTTGGAAGAAGAAGT AGAAAAAGGAATAAATATAGTGATAATTTGATTCTTCGTCGCCGTACTAAGTA
Product
Source
RefSeq
Link:
JCDBP00060
ID
JCDBP00060
Parent
JCDBR00082
Name
YP_002720153.1
Scaffold
NC_012224.1
CDS
91732-92202,92832-93224
Strand:
-
Sequence
MAIHLYKTSTPSTRNGAVDSQVKSNTRNNLIYGQHRCGKGRNARGIITARHRGGGHKRLYRKIDFRRNEKDIYGRIVTIE YDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIISGTEVPIKMGNALPLSEVLIDQKEESTSTDMPLGTAIHNIEITLG KGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNTGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVD HPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNKYSDNLILRRRTK
Product
ribosomal protein L2
Source
RefSeq
Link
YP_002720153.1
InterProScan
IPR002171 Ribosomal protein L2
IPR005880 Ribosomal protein L2, bacterial/organellar-type
IPR008991 Translation protein SH3-like domain
IPR012340 Nucleic acid-binding, OB-fold
IPR014722 Ribosomal protein L2 domain 2
IPR014726 Ribosomal protein L2, domain 3
IPR022666 Ribosomal Proteins L2, RNA binding domain
IPR022669 Ribosomal protein L2, C-terminal
IPR022671 Ribosomal protein L2, conserved site
Pfam
PF00181.19 Ribosomal_L2 Domain
PF03947.14 Ribosomal_L2_C Domain