Detail information of JCDBG00083

JCDBG00083
ID
JCDBG00083
Name
rpl23
Type
protein_coding
Scaffold
NC_012224.1
Start
93243
End
93524
Strand
-
Link
Genbank id:7564776
Molecular function
GO:0000166 | nucleotide binding
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0005622 | intracellular
Biological process
GO:0006412 | translation
KEGG
Entry: K02892
Name: RP-L23, MRPL23, rplW
Definition: large subunit ribosomal protein L23
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TATGGATGGAATCAAATATGCAGTATTTACAGACAAAAGTATTCGGTTATTGGGGAAAAATCAATATACTTTTAATGTCG AATCAGGATCAACTAGGACAGAAATAAAGCATTGGGTCGAGCTCTTCTTTGGTGTCAAGGTAATAGCTATGAATAGCCAT CGACTCCCGGGAAAGGGTAGAAGAATGAGACCTATTATGGGACATACAATGCATTACAGACGTATGATCATTACGCTTCA ACCGGGTTATTCTATTCCACCTCTTAGAAAGAAAAGAACTTA
Gene structure

JCDB Genes gff download

JCDBG00083 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00083's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00083JCDBG10469co-exp0.710229
JCDBG00083JCDBG25063co-exp0.710229
JCDBG00083JCDBG25084co-exp0.710229
JCDBG00083JCDBG22586co-exp0.710229
JCDBG00083JCDBG20224co-exp0.697658
JCDBG00083JCDBG00514co-exp0.697658
JCDBG20224JCDBG00514co-exp1
PPI network
node1node2type
JCDBR00083
ID
JCDBR00083
Name
rpl23
Type
protein_coding
Scaffold
NC_012224.1
Start
93243
End
93524
Strand
-
Exon
93243-93524
Sequence
TATGGATGGAATCAAATATGCAGTATTTACAGACAAAAGTATTCGGTTATTGGGGAAAAATCAATATACTTTTAATGTCG AATCAGGATCAACTAGGACAGAAATAAAGCATTGGGTCGAGCTCTTCTTTGGTGTCAAGGTAATAGCTATGAATAGCCAT CGACTCCCGGGAAAGGGTAGAAGAATGAGACCTATTATGGGACATACAATGCATTACAGACGTATGATCATTACGCTTCA ACCGGGTTATTCTATTCCACCTCTTAGAAAGAAAAGAACTTA
Product
Source
RefSeq
Link:
JCDBP00061
ID
JCDBP00061
Parent
JCDBR00083
Name
YP_002720154.1
Scaffold
NC_012224.1
CDS
93243-93524
Strand:
-
Sequence
MDGIKYAVFTDKSIRLLGKNQYTFNVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQ PGYSIPPLRKKRT
Product
ribosomal protein L23
Source
RefSeq
Link
YP_002720154.1
InterProScan
IPR001014 Ribosomal protein L23/L25, conserved site
IPR012677 Nucleotide-binding alpha-beta plait domain
IPR012678 Ribosomal protein L23/L15e core domain
IPR013025 Ribosomal protein L25/L23
Pfam
PF00276.16 Ribosomal_L23 Family