Detail information of JCDBG00085

JCDBG00085
ID
JCDBG00085
Name
ycf2
Type
protein_coding
Scaffold
NC_012224.1
Start
93852
End
100748
Strand
+
Link
Genbank id:7564778
Molecular function
GO:0005524 | ATP binding
Cellular component
GO:0009507 | chloroplast
Biological process
KEGG
Source
RefSeq
TF
Description
Sequence
TGAAAGGACATCAATTCAAATCCTGGATTTTCGAATTGAGAGAGATATTGAGAGAGATCAAGAATTCTCACTATTTCTTA GATTCATGGACCCAATTCAATTCAGTGGGATCTTTCATTCACATTTTTTTCCATCAAGAACGTTTTATAAAACTCTTGGA CTCCCGAATTTGGAGTATCTTACTTTCACGCAATTCACAGGGTTCAACAAGCAATCGATATTTCACGATCAAGGGTGTAG TACTATTTGTAGTAGTGGTTCTTATATATCGTATTAACAATCGAAAGATGGTCGAAAGAAAAAATCTCTATTTGACAGGG CTTCTTCCTATACCTATGAATTCCATTGGACCCAGAAATGATACATTGGAAGAATCCTTTGGGTCTTCCAATATCAATAG GTTGATTGTTTCGCTCCTGTATCTTCCAAAAGGAAAAAAGATCTCTGAGAGCTCTTTCCTGGATCCGAAAGAGAGTACTT GGGTTCTCCCAATAACTAAAAAGTCTGAATCTAACTGGGGTTCGCGGTGGTGGAGGAACTGGATCGGAAAAAAGAGGGAT TCTAGTTGTAAGATATCTAATGAAACCGTCGCTGGAATTGAGATCTCATTCAAAGAAAAAGATATCAAATATCTGGAGTT TCTTTTTGTATATTATATGGATGATCCGATCCGCAAGGACCATGATTGGGAATTGTTTGATCGTCTTTCTCCGAGGAAGG GGCGAAACATAATCAACTTGAATTCGGGACAGCTATTCGAAATCTTAGTGAAAGACTGGATTTGTTATCTCATGTTTGCT TTTCGCGAAAAAATACCAATTGAAGTGGAGGGTTTCTTCAAACAACAAGGAGCTGGGTCAACTATTCAATCAAATGATAT TGAGCATGTTTCCCATCTCTTCTCGAGAAAGAAGTGGGCTATTTCTTTGCAAAATTGTGCTCAATTTCATATGTGGCAAT TCCGCCAAGATCTCTTCGTTAGTTGGGGGAATAATCCGCACGAATCGGATTTTTTGAGGAACATATCGAGAGAGGATTGG ATTTGGTTAGACAATGTGTGGTTGGTAAACAAGGATCGGTTTTTTAGCAAGGCACGGAATATATCGTCAAATATTCAATA TGATTCCACAAGATCTAGTTTCGTTCAAGGAAGGAATTCTAGCCAATTGAAGGGATCTTCTGATCAATCCAGAGATCATT TCGATTCCATTAGTAATGAGGATTCGGAATATCACACATTGATCAATCAAAGAAAGATTCAACAACTAAAAGAAAGATCG ATTCTTTGGGATCCTTCCTTTCTTCAAACGGAACGAACAGAGATAGAATCAGACCGATTCCCTAAATGCCTTTCTGGATA TTCCTCAATGTCCCGACTATTCACGGAAGGTGAGAAGGAGATGAATAATCATCTGCTTCCGGAAGAAATCGAAGAATTTC TTGGGAATCCTACAAGATCCATTCGTTCTTTTTTCTCTGACAGATCGTCAGAACTTCATCTGGGTTCGAATCCTACTGAG AGGTCCACTAAATTGTTGAAGAAAGAACAAGATGTTTCTTTTGTCCCTTCCAGGCGATCGGAAAATAAAGAAATAGTTAA TATATTCAAGATAATCACGTATTTACAAAATACCGTCTCAATTCATCCTATTTCATCAGATCCGGGATGTGATATGGTTC TGAAGGATGAACTGGATATGGACAGTTCCAATAAGATTTCTTTCTTGAACAAAAATCCATTTTTTGATTTATTTCATCTA TTCCATGATCGGAACGGGGGGGGATACACGTTACACCACGATTTTGAATCAGAAGAGAGATTTCAAGAAATGGCAGATCT ATTCACTCTATCAATAACCGAGCCGGATCTGGTGTATCATAAGGGATTTACCTTTTTTATTGATTCTTACGGATTGGATC AAAAACAATTCTTGAATGAGGTATTCAACTCCAGGGATGAATCGAAAAAGAAATCTTTATTGGTTCTACCTCCTATTTTT TATGAAGAGAATGAATCTTTTTATCGAAGGATCAGAAAAAAATGGGTCCGGATCTCCTGCGGGAATGATTTGGAAGATCC AAAACAAAAAATAGTGGTATTTGCTAGCAACAACATAATGGAGGCAGTCAATCAATATGGATTGATCCTAAATCTGATTC AAATCCAATATAGTACCTATGGGTACATAAGAAATGTATTGACTCAATTCTTTTTAATGAATAGATCCGATCGCAACTTC GAATATGGAATTCAAAGGGATCAAATAGGAAATGATACTCTGAATCATAGAACTATAATGAAATATACGATCAACCAACA TTTATCGAATTTGAAACAGAGTCAGAAGAACTGGTTCGATCCTCTTATTTTTCTTTCTCGAACCGAGAGATCCATGAATT GGGATCCTAATGCATATAGATACAAATGGTCTAATGGGAGCAAGAATTTCCAGGAATATTTGGAACATTTCATTTCTGAG CAGAAGAGCCGTTTTCTTTTTCAAGTAGTGTTCGATCGATTACGTATTAATCAATATTCGATTGATTGGTCTGAGGTTAT CGACAAAAAAGATTTGTCTAAGTCACTTCGTTTCTTTTTGTCCAAGTTACTTGTTTTTTTGTCCAAGTTTCTTCTCTTTT TGTCTAACTCACTTCCTTTTTTCTTTGTGAGTTTCGGGAATATCCCCATTCATAGGTCCGAAATCCATATCTATGAATTG AAAGGTCCGAATGATCCACTCTGCAATCAGCTGTTAGAACCAATAGGTCTTCAAATCGTTCATTTGAAAAAATGGAAACC CTTCTTATTGGATGATCATGATACTTCCCAAAAATCGAAATTTTTGATTAATGGAGGAACAATATCACCATTTTTGTTCA ATAAGATACCAAAGTGGATGATTGACTCATTCCATACTAGAAATAATCGCAGGAAATCTTTTGATAACACGGATTCCTAT TTCTCAATGATATCCCACGATCAAGACAATTGGCTGAATCCCGTGAAACCATTTCATAGAAGTTCATTGATATCTTCTTT TTATAAAACAAATCGACTTCGATTCTTGAATAATCTACATCACTTCTGCTTCTATTGTAACAAAAACAAAAGATTCCCTT TTTATGTGGAAAAGGCCCGTATCAAGAATTATGATTTTACGTATGGACAATTCCTCAATATCTTGTTCATTCGCAACAAA ATATTTTCTTTGTGCGGCGGTAAAAAAAAACATGCTTTTGGGGAGAGAGATACTATTTCACCAATCGAGTCACAGGTATC TAACATATTCATACCTAATGATTTTCCACAAAGTGGTAACGAAAGGTATAACTTGTACAAATCTTTCCATTTTCCAATTC GATCCGATCCATTCGTTCGTAGAGCTATTTATTTGATCGCAGACATTTCGGGAACACCTCTAACAGAGGGACAAATAGTC AATTTTGAAAGAACTTATTGTCAACCTCTTTCGGATATGAATCTATCTGATTCAGAAGGGAAGAACTTGCATCAGTATCT CAATTTCAATTCAAACATGGGTTTGATTCACACTCCATGTTCTGAGAAATATTTACCATCCGAAAAGAGGAAAAAACGGA GTCTTTGTCTAAAGAAATGTGTTGAAAAAGGGCAGATGTATAGAACCTTTCAACGAGATAGTGCTTTTTCAACTCTCTCA AAATGGAATCTATTCCAAACATATATGCCATGGTTCCTTACTTCGACAGGGTACAAATATCTAAATTTGATATTTTTAGA TACCTTTTCGGACCTATTACCGATACTAAGTAGCAGTCAAAAATTTGTATCCATTTTTCATGATATTATGCACGGATCAG ATATATCATGGCGAATTCTTCAGAAAAAATGGTGTCTTCCACAATGGAATCTGATAAGTGAGATTTCGAGTAAGTGTTTA CATAATCTTCTTCTGTCCGAAGAAATGATTCATCGAAATAATGAGCCACCATTGATATCGACACATCTGAGATCGCCAAA TGTTCGGGAGTTCCTCTATTCAATCCTTTTCCTTCTTCTTGTTGCTGGATATCTCGTTCGTACACATCTTCTCTTTGTTT CCCGAGCCTATAGTGAGTTACAGACAGAGTTCGAAAAGGTCAAATCTTTGATGATTCCATCATACATGATTGAGTTGCGA AAACTTCTGGATAGGTATCCTACATCTGAACTGAATTCTTTCTGGTTAAAGAATCTCTTTCTAGTTGCTCTGGAACAATT AGGAGATTTTCTAGAAGAAATGCGGGGTTTTGCTTCTGGCGGCAACATGCTATGGGGTGGTGGTCCCGCTTATGGGGTTA AATCAATACGTTCTAAGAATAAATTTTTGAATATCAATCTCATCGATCTCATAAGTATCATACCAAATCCCATCAATCGA ATCACTTTTTCGAGAAATACGAGACATCTAAGTCATACAAGTAAAGAGATTTATTCATTGATAAGAAAAAGAAAAAACGT GAATGGTGATTGGATTGATGATAAAATAGAATCCTTGGTCGCGAACAGTGATTCGATTGATGATAAAGAAAGAGAATTCT TGGTTCAGTTCTCCACCTTAACGACAGAAAACAGGATTGATCAAATTCTATTGAGTCTGACGCATAGTGATCATTTATCA AAGAATGACTCTGGTTATCAAATGATTGAAGAGCCGGGAGCAATTTATTTACGATACTTAGTTGACATTCATAAAAAGTA TCTAATGAATTATGAGTTCAATACACCCTGTTTAGCAGAAAGACGGATATTCCTTGCTTATTATCAGACAACCACTTATT CACAAACCTCGTGTGGGGTGAATAGTTTTCATTTCCCATCTCATGGAAAACCCTTTTCGCTCCGCTTAGCCCTATCCCCC TCTAGGGGTATTTTAGTGATAGGTTCTATAGGAACTGGACGATCCTATTTGGTCAAATACCTAGCGACAAACTCCTATCT TCCTTTCATTACAGTATTTCTGAACAAGTTCCTGGATAACAAGCCTAAGGGCTTTCTTATTGATGATAGTGACGATATTG ATGATAGTGACGATATTGATGATAGTGACGATATTGATGATAGTGACGATATTGATGTGAGTGACGATATTGATGATAGT GACGATATCGACCGTGACTTTGATACGGAGCTGGAGTTTCTAACTAGGATGAATGCGCTAACTATGGGTATGATGCCGGA AATAGACCGATTTTATATCACCCTTCAATTCGAATTAGCAAAAGCAATGTCTCCTTGCATAATATGGATTCCAAACATTC ATGATTTGGATGTGAATGAGTCGAATTACTTATCCCTCGGTCTATTAGTGAACTATCTCTCCAGGGATTGTGAAAGATGT TCCACTAGAAATATTCTTGTTATTGCTTCGACTCATATTCCCCAAAAAGTGGATCCCGCTCTAATAGCTCCGAATAAATT AAATACATGCATTAAGATACGAAGGCTTCTTATTCCACAACAACGAAAGCACTTTTTTACTCTTTCATATACTAGGGGAT TTCACTTGGAAAAGAAAATGCTCCATACTAATGGATTCGGGTCCATAACCATGGGTTCCAATGTACGAGATCTTGTAGCA CTTACCAATGAGGCCCTATCGATTAGTATTACACAGAAGAAATCAATTCTAGACACTAATATAATTAGATCCGCTCTTCA TAGACAAACTTGGGATTTGCGATCCCAGGTAAGATCGGTTCAGGATCATGGGATCCTTTTCTATCAGATAGGAAGGGCTG TTGCACAAAATGTATTTCTAAGTAATTGCCCCATAGATCCTATATCTATCTATATGAAGAAGAAATCATGTAACGAAGGG GATTCTTATTTGTACAAATGGTACTTCGAACTTGGAATGAGCATGAAGAAATTAACGATACTTCTTTATCTTTTGAGTTG TTCCGCCGGATCGGTTGCTCAAGACCTTTGGTCTCTACCCGGACCCGATGAAAAAAATGGGATCACTTATTATGGACTTG TTGAGAATGATTCTGATCTAGTTCATGGCCTATTAGAAGTCGAAGGCGCTCTGGTGGGATCCTCACGTACAGAAAAAGAT TGCAGTCAGTTTGATAATGATCGAGTGACATTGCTTCTTCGGCCCGAACCAAAGAGTCCCTTAGATATGATGCAAAATGG ATCTTGTTCTATCCTTGATCAGAGATTTCTCTATGAAAAATACGAATCGGAGTTTGAAGAAGGGGAAGGAGTCCTCGACC CGCAACAGATAGAGGAGGATTTATTCAATCACATAGTTTGGGCTCCTAGAATATGGCGCCCTTGGGGTTTTCTATTTGAT TGTATCGAAAGGCCCAATGAATTGGGATTTCCCTATTGGGCCAGGTCATTTCGGGGCAAGCGGATCATTTATGATGAAGA GGATGAGCTTCAAGAGAATGATTCGGAGTTCTTGCAGAGTGGAACCATGCAGTACCAGATACGAGATAGATCTTCCAAAG AACAAGGCTTTTTTCGAATAAGCCAATTCATTTGGGACCCTGCGGATCCACTCTTTTTCCTATTCAAAGATCAGCCCTTT GTCTCTGTGTTTTCACATCGAGAATTCTTTGCAGATGAAGAGATGTCAAAGGGGCTTCTTACTTCCCAAACAGATCCTCC TACATCTATATATAAACGCTGGTTTATCAAGAATACGCAAGAAAAGCACTTCGAATTGTTGATTCATCGCCAGAGATGGC TTAGAACCAATAGTTCATTATCTAATGGATTTTTCCGTTCTAATACTCTATCCGAGAGTTATCAGTATTTATCAAATCTG TTCCTATCTAACGGAACGCTATTGGATCAAATGACAAAGGCATTGTTGAGAAAAAGATGGCTTTTCCCGGATGAAATGAA AATTGGATTCATGTAAT
Gene structure

JCDB Genes gff download

JCDBG00085 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00085's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00085JCDBG24849co-exp0.618131
JCDBG00085JCDBG13317co-exp0.618031
PPI network
node1node2type
JCDBR00085
ID
JCDBR00085
Name
ycf2
Type
protein_coding
Scaffold
NC_012224.1
Start
93852
End
100748
Strand
+
Exon
93852-100748
Sequence
TGAAAGGACATCAATTCAAATCCTGGATTTTCGAATTGAGAGAGATATTGAGAGAGATCAAGAATTCTCACTATTTCTTA GATTCATGGACCCAATTCAATTCAGTGGGATCTTTCATTCACATTTTTTTCCATCAAGAACGTTTTATAAAACTCTTGGA CTCCCGAATTTGGAGTATCTTACTTTCACGCAATTCACAGGGTTCAACAAGCAATCGATATTTCACGATCAAGGGTGTAG TACTATTTGTAGTAGTGGTTCTTATATATCGTATTAACAATCGAAAGATGGTCGAAAGAAAAAATCTCTATTTGACAGGG CTTCTTCCTATACCTATGAATTCCATTGGACCCAGAAATGATACATTGGAAGAATCCTTTGGGTCTTCCAATATCAATAG GTTGATTGTTTCGCTCCTGTATCTTCCAAAAGGAAAAAAGATCTCTGAGAGCTCTTTCCTGGATCCGAAAGAGAGTACTT GGGTTCTCCCAATAACTAAAAAGTCTGAATCTAACTGGGGTTCGCGGTGGTGGAGGAACTGGATCGGAAAAAAGAGGGAT TCTAGTTGTAAGATATCTAATGAAACCGTCGCTGGAATTGAGATCTCATTCAAAGAAAAAGATATCAAATATCTGGAGTT TCTTTTTGTATATTATATGGATGATCCGATCCGCAAGGACCATGATTGGGAATTGTTTGATCGTCTTTCTCCGAGGAAGG GGCGAAACATAATCAACTTGAATTCGGGACAGCTATTCGAAATCTTAGTGAAAGACTGGATTTGTTATCTCATGTTTGCT TTTCGCGAAAAAATACCAATTGAAGTGGAGGGTTTCTTCAAACAACAAGGAGCTGGGTCAACTATTCAATCAAATGATAT TGAGCATGTTTCCCATCTCTTCTCGAGAAAGAAGTGGGCTATTTCTTTGCAAAATTGTGCTCAATTTCATATGTGGCAAT TCCGCCAAGATCTCTTCGTTAGTTGGGGGAATAATCCGCACGAATCGGATTTTTTGAGGAACATATCGAGAGAGGATTGG ATTTGGTTAGACAATGTGTGGTTGGTAAACAAGGATCGGTTTTTTAGCAAGGCACGGAATATATCGTCAAATATTCAATA TGATTCCACAAGATCTAGTTTCGTTCAAGGAAGGAATTCTAGCCAATTGAAGGGATCTTCTGATCAATCCAGAGATCATT TCGATTCCATTAGTAATGAGGATTCGGAATATCACACATTGATCAATCAAAGAAAGATTCAACAACTAAAAGAAAGATCG ATTCTTTGGGATCCTTCCTTTCTTCAAACGGAACGAACAGAGATAGAATCAGACCGATTCCCTAAATGCCTTTCTGGATA TTCCTCAATGTCCCGACTATTCACGGAAGGTGAGAAGGAGATGAATAATCATCTGCTTCCGGAAGAAATCGAAGAATTTC TTGGGAATCCTACAAGATCCATTCGTTCTTTTTTCTCTGACAGATCGTCAGAACTTCATCTGGGTTCGAATCCTACTGAG AGGTCCACTAAATTGTTGAAGAAAGAACAAGATGTTTCTTTTGTCCCTTCCAGGCGATCGGAAAATAAAGAAATAGTTAA TATATTCAAGATAATCACGTATTTACAAAATACCGTCTCAATTCATCCTATTTCATCAGATCCGGGATGTGATATGGTTC TGAAGGATGAACTGGATATGGACAGTTCCAATAAGATTTCTTTCTTGAACAAAAATCCATTTTTTGATTTATTTCATCTA TTCCATGATCGGAACGGGGGGGGATACACGTTACACCACGATTTTGAATCAGAAGAGAGATTTCAAGAAATGGCAGATCT ATTCACTCTATCAATAACCGAGCCGGATCTGGTGTATCATAAGGGATTTACCTTTTTTATTGATTCTTACGGATTGGATC AAAAACAATTCTTGAATGAGGTATTCAACTCCAGGGATGAATCGAAAAAGAAATCTTTATTGGTTCTACCTCCTATTTTT TATGAAGAGAATGAATCTTTTTATCGAAGGATCAGAAAAAAATGGGTCCGGATCTCCTGCGGGAATGATTTGGAAGATCC AAAACAAAAAATAGTGGTATTTGCTAGCAACAACATAATGGAGGCAGTCAATCAATATGGATTGATCCTAAATCTGATTC AAATCCAATATAGTACCTATGGGTACATAAGAAATGTATTGACTCAATTCTTTTTAATGAATAGATCCGATCGCAACTTC GAATATGGAATTCAAAGGGATCAAATAGGAAATGATACTCTGAATCATAGAACTATAATGAAATATACGATCAACCAACA TTTATCGAATTTGAAACAGAGTCAGAAGAACTGGTTCGATCCTCTTATTTTTCTTTCTCGAACCGAGAGATCCATGAATT GGGATCCTAATGCATATAGATACAAATGGTCTAATGGGAGCAAGAATTTCCAGGAATATTTGGAACATTTCATTTCTGAG CAGAAGAGCCGTTTTCTTTTTCAAGTAGTGTTCGATCGATTACGTATTAATCAATATTCGATTGATTGGTCTGAGGTTAT CGACAAAAAAGATTTGTCTAAGTCACTTCGTTTCTTTTTGTCCAAGTTACTTGTTTTTTTGTCCAAGTTTCTTCTCTTTT TGTCTAACTCACTTCCTTTTTTCTTTGTGAGTTTCGGGAATATCCCCATTCATAGGTCCGAAATCCATATCTATGAATTG AAAGGTCCGAATGATCCACTCTGCAATCAGCTGTTAGAACCAATAGGTCTTCAAATCGTTCATTTGAAAAAATGGAAACC CTTCTTATTGGATGATCATGATACTTCCCAAAAATCGAAATTTTTGATTAATGGAGGAACAATATCACCATTTTTGTTCA ATAAGATACCAAAGTGGATGATTGACTCATTCCATACTAGAAATAATCGCAGGAAATCTTTTGATAACACGGATTCCTAT TTCTCAATGATATCCCACGATCAAGACAATTGGCTGAATCCCGTGAAACCATTTCATAGAAGTTCATTGATATCTTCTTT TTATAAAACAAATCGACTTCGATTCTTGAATAATCTACATCACTTCTGCTTCTATTGTAACAAAAACAAAAGATTCCCTT TTTATGTGGAAAAGGCCCGTATCAAGAATTATGATTTTACGTATGGACAATTCCTCAATATCTTGTTCATTCGCAACAAA ATATTTTCTTTGTGCGGCGGTAAAAAAAAACATGCTTTTGGGGAGAGAGATACTATTTCACCAATCGAGTCACAGGTATC TAACATATTCATACCTAATGATTTTCCACAAAGTGGTAACGAAAGGTATAACTTGTACAAATCTTTCCATTTTCCAATTC GATCCGATCCATTCGTTCGTAGAGCTATTTATTTGATCGCAGACATTTCGGGAACACCTCTAACAGAGGGACAAATAGTC AATTTTGAAAGAACTTATTGTCAACCTCTTTCGGATATGAATCTATCTGATTCAGAAGGGAAGAACTTGCATCAGTATCT CAATTTCAATTCAAACATGGGTTTGATTCACACTCCATGTTCTGAGAAATATTTACCATCCGAAAAGAGGAAAAAACGGA GTCTTTGTCTAAAGAAATGTGTTGAAAAAGGGCAGATGTATAGAACCTTTCAACGAGATAGTGCTTTTTCAACTCTCTCA AAATGGAATCTATTCCAAACATATATGCCATGGTTCCTTACTTCGACAGGGTACAAATATCTAAATTTGATATTTTTAGA TACCTTTTCGGACCTATTACCGATACTAAGTAGCAGTCAAAAATTTGTATCCATTTTTCATGATATTATGCACGGATCAG ATATATCATGGCGAATTCTTCAGAAAAAATGGTGTCTTCCACAATGGAATCTGATAAGTGAGATTTCGAGTAAGTGTTTA CATAATCTTCTTCTGTCCGAAGAAATGATTCATCGAAATAATGAGCCACCATTGATATCGACACATCTGAGATCGCCAAA TGTTCGGGAGTTCCTCTATTCAATCCTTTTCCTTCTTCTTGTTGCTGGATATCTCGTTCGTACACATCTTCTCTTTGTTT CCCGAGCCTATAGTGAGTTACAGACAGAGTTCGAAAAGGTCAAATCTTTGATGATTCCATCATACATGATTGAGTTGCGA AAACTTCTGGATAGGTATCCTACATCTGAACTGAATTCTTTCTGGTTAAAGAATCTCTTTCTAGTTGCTCTGGAACAATT AGGAGATTTTCTAGAAGAAATGCGGGGTTTTGCTTCTGGCGGCAACATGCTATGGGGTGGTGGTCCCGCTTATGGGGTTA AATCAATACGTTCTAAGAATAAATTTTTGAATATCAATCTCATCGATCTCATAAGTATCATACCAAATCCCATCAATCGA ATCACTTTTTCGAGAAATACGAGACATCTAAGTCATACAAGTAAAGAGATTTATTCATTGATAAGAAAAAGAAAAAACGT GAATGGTGATTGGATTGATGATAAAATAGAATCCTTGGTCGCGAACAGTGATTCGATTGATGATAAAGAAAGAGAATTCT TGGTTCAGTTCTCCACCTTAACGACAGAAAACAGGATTGATCAAATTCTATTGAGTCTGACGCATAGTGATCATTTATCA AAGAATGACTCTGGTTATCAAATGATTGAAGAGCCGGGAGCAATTTATTTACGATACTTAGTTGACATTCATAAAAAGTA TCTAATGAATTATGAGTTCAATACACCCTGTTTAGCAGAAAGACGGATATTCCTTGCTTATTATCAGACAACCACTTATT CACAAACCTCGTGTGGGGTGAATAGTTTTCATTTCCCATCTCATGGAAAACCCTTTTCGCTCCGCTTAGCCCTATCCCCC TCTAGGGGTATTTTAGTGATAGGTTCTATAGGAACTGGACGATCCTATTTGGTCAAATACCTAGCGACAAACTCCTATCT TCCTTTCATTACAGTATTTCTGAACAAGTTCCTGGATAACAAGCCTAAGGGCTTTCTTATTGATGATAGTGACGATATTG ATGATAGTGACGATATTGATGATAGTGACGATATTGATGATAGTGACGATATTGATGTGAGTGACGATATTGATGATAGT GACGATATCGACCGTGACTTTGATACGGAGCTGGAGTTTCTAACTAGGATGAATGCGCTAACTATGGGTATGATGCCGGA AATAGACCGATTTTATATCACCCTTCAATTCGAATTAGCAAAAGCAATGTCTCCTTGCATAATATGGATTCCAAACATTC ATGATTTGGATGTGAATGAGTCGAATTACTTATCCCTCGGTCTATTAGTGAACTATCTCTCCAGGGATTGTGAAAGATGT TCCACTAGAAATATTCTTGTTATTGCTTCGACTCATATTCCCCAAAAAGTGGATCCCGCTCTAATAGCTCCGAATAAATT AAATACATGCATTAAGATACGAAGGCTTCTTATTCCACAACAACGAAAGCACTTTTTTACTCTTTCATATACTAGGGGAT TTCACTTGGAAAAGAAAATGCTCCATACTAATGGATTCGGGTCCATAACCATGGGTTCCAATGTACGAGATCTTGTAGCA CTTACCAATGAGGCCCTATCGATTAGTATTACACAGAAGAAATCAATTCTAGACACTAATATAATTAGATCCGCTCTTCA TAGACAAACTTGGGATTTGCGATCCCAGGTAAGATCGGTTCAGGATCATGGGATCCTTTTCTATCAGATAGGAAGGGCTG TTGCACAAAATGTATTTCTAAGTAATTGCCCCATAGATCCTATATCTATCTATATGAAGAAGAAATCATGTAACGAAGGG GATTCTTATTTGTACAAATGGTACTTCGAACTTGGAATGAGCATGAAGAAATTAACGATACTTCTTTATCTTTTGAGTTG TTCCGCCGGATCGGTTGCTCAAGACCTTTGGTCTCTACCCGGACCCGATGAAAAAAATGGGATCACTTATTATGGACTTG TTGAGAATGATTCTGATCTAGTTCATGGCCTATTAGAAGTCGAAGGCGCTCTGGTGGGATCCTCACGTACAGAAAAAGAT TGCAGTCAGTTTGATAATGATCGAGTGACATTGCTTCTTCGGCCCGAACCAAAGAGTCCCTTAGATATGATGCAAAATGG ATCTTGTTCTATCCTTGATCAGAGATTTCTCTATGAAAAATACGAATCGGAGTTTGAAGAAGGGGAAGGAGTCCTCGACC CGCAACAGATAGAGGAGGATTTATTCAATCACATAGTTTGGGCTCCTAGAATATGGCGCCCTTGGGGTTTTCTATTTGAT TGTATCGAAAGGCCCAATGAATTGGGATTTCCCTATTGGGCCAGGTCATTTCGGGGCAAGCGGATCATTTATGATGAAGA GGATGAGCTTCAAGAGAATGATTCGGAGTTCTTGCAGAGTGGAACCATGCAGTACCAGATACGAGATAGATCTTCCAAAG AACAAGGCTTTTTTCGAATAAGCCAATTCATTTGGGACCCTGCGGATCCACTCTTTTTCCTATTCAAAGATCAGCCCTTT GTCTCTGTGTTTTCACATCGAGAATTCTTTGCAGATGAAGAGATGTCAAAGGGGCTTCTTACTTCCCAAACAGATCCTCC TACATCTATATATAAACGCTGGTTTATCAAGAATACGCAAGAAAAGCACTTCGAATTGTTGATTCATCGCCAGAGATGGC TTAGAACCAATAGTTCATTATCTAATGGATTTTTCCGTTCTAATACTCTATCCGAGAGTTATCAGTATTTATCAAATCTG TTCCTATCTAACGGAACGCTATTGGATCAAATGACAAAGGCATTGTTGAGAAAAAGATGGCTTTTCCCGGATGAAATGAA AATTGGATTCATGTAAT
Product
Source
RefSeq
Link:
JCDBP00062
ID
JCDBP00062
Parent
JCDBR00085
Name
YP_002720155.1
Scaffold
NC_012224.1
CDS
93852-100748
Strand:
+
Sequence
MKGHQFKSWIFELREILREIKNSHYFLDSWTQFNSVGSFIHIFFHQERFIKLLDSRIWSILLSRNSQGSTSNRYFTIKGV VLFVVVVLIYRINNRKMVERKNLYLTGLLPIPMNSIGPRNDTLEESFGSSNINRLIVSLLYLPKGKKISESSFLDPKEST WVLPITKKSESNWGSRWWRNWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPIRKDHDWELFDRLSPRK GRNIINLNSGQLFEILVKDWICYLMFAFREKIPIEVEGFFKQQGAGSTIQSNDIEHVSHLFSRKKWAISLQNCAQFHMWQ FRQDLFVSWGNNPHESDFLRNISREDWIWLDNVWLVNKDRFFSKARNISSNIQYDSTRSSFVQGRNSSQLKGSSDQSRDH FDSISNEDSEYHTLINQRKIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGYSSMSRLFTEGEKEMNNHLLPEEIEEF LGNPTRSIRSFFSDRSSELHLGSNPTERSTKLLKKEQDVSFVPSRRSENKEIVNIFKIITYLQNTVSIHPISSDPGCDMV LKDELDMDSSNKISFLNKNPFFDLFHLFHDRNGGGYTLHHDFESEERFQEMADLFTLSITEPDLVYHKGFTFFIDSYGLD QKQFLNEVFNSRDESKKKSLLVLPPIFYEENESFYRRIRKKWVRISCGNDLEDPKQKIVVFASNNIMEAVNQYGLILNLI QIQYSTYGYIRNVLTQFFLMNRSDRNFEYGIQRDQIGNDTLNHRTIMKYTINQHLSNLKQSQKNWFDPLIFLSRTERSMN WDPNAYRYKWSNGSKNFQEYLEHFISEQKSRFLFQVVFDRLRINQYSIDWSEVIDKKDLSKSLRFFLSKLLVFLSKFLLF LSNSLPFFFVSFGNIPIHRSEIHIYELKGPNDPLCNQLLEPIGLQIVHLKKWKPFLLDDHDTSQKSKFLINGGTISPFLF NKIPKWMIDSFHTRNNRRKSFDNTDSYFSMISHDQDNWLNPVKPFHRSSLISSFYKTNRLRFLNNLHHFCFYCNKNKRFP FYVEKARIKNYDFTYGQFLNILFIRNKIFSLCGGKKKHAFGERDTISPIESQVSNIFIPNDFPQSGNERYNLYKSFHFPI RSDPFVRRAIYLIADISGTPLTEGQIVNFERTYCQPLSDMNLSDSEGKNLHQYLNFNSNMGLIHTPCSEKYLPSEKRKKR SLCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQTYMPWFLTSTGYKYLNLIFLDTFSDLLPILSSSQKFVSIFHDIMHGS DISWRILQKKWCLPQWNLISEISSKCLHNLLLSEEMIHRNNEPPLISTHLRSPNVREFLYSILFLLLVAGYLVRTHLLFV SRAYSELQTEFEKVKSLMIPSYMIELRKLLDRYPTSELNSFWLKNLFLVALEQLGDFLEEMRGFASGGNMLWGGGPAYGV KSIRSKNKFLNINLIDLISIIPNPINRITFSRNTRHLSHTSKEIYSLIRKRKNVNGDWIDDKIESLVANSDSIDDKEREF LVQFSTLTTENRIDQILLSLTHSDHLSKNDSGYQMIEEPGAIYLRYLVDIHKKYLMNYEFNTPCLAERRIFLAYYQTTTY SQTSCGVNSFHFPSHGKPFSLRLALSPSRGILVIGSIGTGRSYLVKYLATNSYLPFITVFLNKFLDNKPKGFLIDDSDDI DDSDDIDDSDDIDDSDDIDVSDDIDDSDDIDRDFDTELEFLTRMNALTMGMMPEIDRFYITLQFELAKAMSPCIIWIPNI HDLDVNESNYLSLGLLVNYLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQQRKHFFTLSYTRG FHLEKKMLHTNGFGSITMGSNVRDLVALTNEALSISITQKKSILDTNIIRSALHRQTWDLRSQVRSVQDHGILFYQIGRA VAQNVFLSNCPIDPISIYMKKKSCNEGDSYLYKWYFELGMSMKKLTILLYLLSCSAGSVAQDLWSLPGPDEKNGITYYGL VENDSDLVHGLLEVEGALVGSSRTEKDCSQFDNDRVTLLLRPEPKSPLDMMQNGSCSILDQRFLYEKYESEFEEGEGVLD PQQIEEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYWARSFRGKRIIYDEEDELQENDSEFLQSGTMQYQIRDRSSK EQGFFRISQFIWDPADPLFFLFKDQPFVSVFSHREFFADEEMSKGLLTSQTDPPTSIYKRWFIKNTQEKHFELLIHRQRW LRTNSSLSNGFFRSNTLSESYQYLSNLFLSNGTLLDQMTKALLRKRWLFPDEMKIGFM
Product
Ycf2
Source
RefSeq
Link
YP_002720155.1
InterProScan
IPR003593 AAA+ ATPase domain
IPR003959 ATPase, AAA-type, core
IPR008543 Uncharacterised protein family Ycf2
IPR027417 P-loop containing nucleoside triphosphate hydrolase
Pfam
PF05695.8 DUF825 Family
PF00004.25 AAA Family