Detail information of JCDBG00086

JCDBG00086
ID
JCDBG00086
Name
ORF126
Type
protein_coding
Scaffold
NC_012224.1
Start
101219
End
101599
Strand
-
Link
Genbank id:7564779 | Jatropha Genome Database ID:Jcr4U30824.10
Molecular function
Cellular component
Biological process
KEGG
Source
RefSeq
TF
Description
Sequence
AATGAATGGGGAGTCCGCTTTGAAAGCGTCCGCCCTGCAACCACCCCCGAGTATATGCTTCAACAGGAATTACACAAGGG TAGTTGATACAATAGAAACCTCTGGTAAAATGCCCGCCCGTAACCCAACAGATAAAGTACATTACATAGTCCGTTTTAGG GATTGGCGACTTACCCATTCAGTGACTTTGGCACTGGATGTTCCAAAAAGAAAATGGGTACTCTCGGGTCGGGTGAATTC AATAATAGACGTCTGTTGGCATTCCAGCCTTCCTTCTCCTTTCAGGGCCTATCCGAAAGAGAATCCAGTACTTCTTGGTC GTGAATATCTGAATAGGACAAACCGCCCCGTGGATATCTTTGCTTCGGAACAAAACAATTA
Gene structure

JCDB Genes gff download

JCDBG00086 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00086
ID
JCDBR00086
Name
ORF126
Type
protein_coding
Scaffold
NC_012224.1
Start
101219
End
101599
Strand
-
Exon
101219-101599
Sequence
AATGAATGGGGAGTCCGCTTTGAAAGCGTCCGCCCTGCAACCACCCCCGAGTATATGCTTCAACAGGAATTACACAAGGG TAGTTGATACAATAGAAACCTCTGGTAAAATGCCCGCCCGTAACCCAACAGATAAAGTACATTACATAGTCCGTTTTAGG GATTGGCGACTTACCCATTCAGTGACTTTGGCACTGGATGTTCCAAAAAGAAAATGGGTACTCTCGGGTCGGGTGAATTC AATAATAGACGTCTGTTGGCATTCCAGCCTTCCTTCTCCTTTCAGGGCCTATCCGAAAGAGAATCCAGTACTTCTTGGTC GTGAATATCTGAATAGGACAAACCGCCCCGTGGATATCTTTGCTTCGGAACAAAACAATTA
Product
Source
RefSeq
Link:
JCDBP00063
ID
JCDBP00063
Parent
JCDBR00086
Name
YP_002720156.1
Scaffold
NC_012224.1
CDS
101219-101599
Strand:
-
Sequence
MNGESALKASALQPPPSICFNRNYTRVVDTIETSGKMPARNPTDKVHYIVRFRDWRLTHSVTLALDVPKRKWVLSGRVNS IIDVCWHSSLPSPFRAYPKENPVLLGREYLNRTNRPVDIFASEQNN
Product
ORF126
Source
RefSeq
Link
YP_002720156.1
InterProScan
Pfam