Detail information of JCDBG00088

JCDBG00088
ID
JCDBG00088
Name
ndhB
Type
protein_coding
Scaffold
NC_012224.1
Start
102419
End
104627
Strand
-
Link
Genbank id:7564781
Molecular function
GO:0008137 | NADH dehydrogenase (ubiquinone) activity
Cellular component
Biological process
GO:0042773 | ATP synthesis coupled electron transport
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05573
Name: ndhB
Definition: NAD(P)H-quinone oxidoreductase subunit 2 [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
CATGATCTGGCATGTACAGAATGAAAACTTCATTCTCGATTCTACGAGAATTTTTATGAAAGCCTTTCATTTGCTTCTCT TCGATGGAAGTTTTATTTTCCCAGAATGTATCCTAATTTTTGGCCTAATTCTTCTTCTGATGATCGATTCAACCTCTGAT CAAAAAGATATACCTTGGTTATATTTCATCTCTTCAACAAGTTTAGTAATGAGTATAACGGCCCTATTGTTCCGATGGAG AGAAGAACCTATGATTAGCTTTTCGGGAAATTTCCAAACGAACAATTTCAACGAAATCTTTCAATTTCTTATTTTACTAT GTTCCACTCTATGTATTCCTCTATCCGTAGAGTACATTGAATGTACAGAAATGGCTATAACAGAGTTTCTCTTATTCCTA TTAACAGCTACTCTAGGAGGAATGTTTTTATGCGGTGCTAACGATTTAATAACTATCTTTGTAGCTCCAGAATGTTTCAG TTTATGCTCCTACCTATTATCTGGATATACCAAGAAAGATGTACGGTCTAATGAGGCTACTACGAAATATTTACTCATGG GTGGGGCAAGCTCTTCTATTCTGGTTCATGCTTTCTCTTGGCTATATGGTTCGTCCGGGGGAGAGATCGAGCTTCAAGAA ATAGTGAATGGCCTTATCAATACACAAATGTATAACTCCCCAGGAATTTCAATTGCGCTTATATTCATCACTGTAGGAAT CGGGTTCAAGCTTTCCCCAGCCCCTTCTCATCAATGGACTCCTGACGTATACGAAGGAGTGCGGTTCGTTCGAAAAATTC CTACCTCTCTATCTATCTCTGAGATGCTTGGATTTTTCAAAACTCCATGGACATGCAGAAGAGAAATGCTATCCCCACTC GGACCAAGACATAACTTTTACTTGTTCAAATAACAATTAAGGTGAAGCAGGGTCAGGAACAACGAATCTCTTTATGATAA ACAGATTCATTTTGCAAGTTCGTTATTACGGGTAGCTCCTACAAAAGATCGGACTAATGACGTATACAATACTTAAACTC TCGATGTAGATGCTACATAGTTGGTTCTCATCCTTCAGAGACTACGAATGTAATAGGAGCATCCGTCGACAAAAGGATCA CCCTAAGATGATCATCTCATGGCTATTGAGAACGAATCAAATCAGATGGTTCTATTTCTCAATCTTTCTGACTTGCTCCT ACGGAACCAAGAGGTCGAAAAGATTGAGAAAAATCGGTCATTCACAACCACTGATGAAGGATTCCTCGAAAAGTTAAGGA TTAGTAATCCTTTTTAGAAATCGAATGGATTCGGTCTTATACATACGCGAGGAAAGTAATCAAAAAAGAAAGAAGAACTC ATCTTCTTTCTTTTATCACTTAGGAGCCGTGCGAGATGAAAATCTCATGCACGGTTTTGAATGAGAGAAAGAAGTGAGGA ATCCTCTTTTCGACTCTGACTCTCCCACTCCAGTCGTTGCTTTTCTTTCTGTTACTTCGAAAGTAGCTGCTTCAGCTTCA GCCACTCGAATTTTCGATATTCCTTTTTATTTCTCATCAAACGAATGGCATCTTCTTCTGGAAATCCTAGCTTTTCTGAG CATGATAGTGGGGAATCTCATTGCTATTACTCAAACAAGCATGAAACGTATGCTTGCATATTCGTCCATAGGTCAAATCG GATATGTAATTATTGGAATAATTGTTGGAGACTCAAATGGTGGATATGCAAGCATGATAACTTATATGCTCTTCTATATC TCCATGAATCTAGGAACTTTTGCTTGTATTGTATTATTTGGTCTACGTACCGGAACTGATAACATTCGAGATTATGCAGG ATTATACACGAAAGATCCTTTTTTGGCTCTCTCTTTAGCCCTATGTCTCTTATCCCTAGGAGGTCTTCCTCCACTAGCAG GTTTTTTCGGAAAACTCCATTTATTCTGGTGTGGATGGCAGGCAGGCCTATATTTCTTGGTTTTAATAGGACTCCTTACG AGCGTTGTTTCTATCTACTATTATCTAAAAATAATCAAGTTATTAATGACTGGACGAAACCAAGAAAGAACCTCTCACGT GCGAAATTATAGAACTTTAAGATCAAACAATTCCATCGAATTGAGTATGATTGTATGTGTGATAGCATCTACTATACCGG GAATATCAATGAACCCGATTATTGAAATTGCTCAAGATACCCTTTTTTA
Gene structure

JCDB Genes gff download

JCDBG00088 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00088
ID
JCDBR00088
Name
ndhB
Type
protein_coding
Scaffold
NC_012224.1
Start
102419
End
104627
Strand
-
Exon
102419-103168,103851-104627
Sequence
CATGATCTGGCATGTACAGAATGAAAACTTCATTCTCGATTCTACGAGAATTTTTATGAAAGCCTTTCATTTGCTTCTCT TCGATGGAAGTTTTATTTTCCCAGAATGTATCCTAATTTTTGGCCTAATTCTTCTTCTGATGATCGATTCAACCTCTGAT CAAAAAGATATACCTTGGTTATATTTCATCTCTTCAACAAGTTTAGTAATGAGTATAACGGCCCTATTGTTCCGATGGAG AGAAGAACCTATGATTAGCTTTTCGGGAAATTTCCAAACGAACAATTTCAACGAAATCTTTCAATTTCTTATTTTACTAT GTTCCACTCTATGTATTCCTCTATCCGTAGAGTACATTGAATGTACAGAAATGGCTATAACAGAGTTTCTCTTATTCCTA TTAACAGCTACTCTAGGAGGAATGTTTTTATGCGGTGCTAACGATTTAATAACTATCTTTGTAGCTCCAGAATGTTTCAG TTTATGCTCCTACCTATTATCTGGATATACCAAGAAAGATGTACGGTCTAATGAGGCTACTACGAAATATTTACTCATGG GTGGGGCAAGCTCTTCTATTCTGGTTCATGCTTTCTCTTGGCTATATGGTTCGTCCGGGGGAGAGATCGAGCTTCAAGAA ATAGTGAATGGCCTTATCAATACACAAATGTATAACTCCCCAGGAATTTCAATTGCGCTTATATTCATCACTGTAGGAAT CGGGTTCAAGCTTTCCCCAGCCCCTTCTCATCAATGGACTCCTGACGTATACGAAGGAGTGCGGTTCGTTCGAAAAATTC CTACCTCTCTATCTATCTCTGAGATGCTTGGATTTTTCAAAACTCCATGGACATGCAGAAGAGAAATGCTATCCCCACTC GGACCAAGACATAACTTTTACTTGTTCAAATAACAATTAAGGTGAAGCAGGGTCAGGAACAACGAATCTCTTTATGATAA ACAGATTCATTTTGCAAGTTCGTTATTACGGGTAGCTCCTACAAAAGATCGGACTAATGACGTATACAATACTTAAACTC TCGATGTAGATGCTACATAGTTGGTTCTCATCCTTCAGAGACTACGAATGTAATAGGAGCATCCGTCGACAAAAGGATCA CCCTAAGATGATCATCTCATGGCTATTGAGAACGAATCAAATCAGATGGTTCTATTTCTCAATCTTTCTGACTTGCTCCT ACGGAACCAAGAGGTCGAAAAGATTGAGAAAAATCGGTCATTCACAACCACTGATGAAGGATTCCTCGAAAAGTTAAGGA TTAGTAATCCTTTTTAGAAATCGAATGGATTCGGTCTTATACATACGCGAGGAAAGTAATCAAAAAAGAAAGAAGAACTC ATCTTCTTTCTTTTATCACTTAGGAGCCGTGCGAGATGAAAATCTCATGCACGGTTTTGAATGAGAGAAAGAAGTGAGGA ATCCTCTTTTCGACTCTGACTCTCCCACTCCAGTCGTTGCTTTTCTTTCTGTTACTTCGAAAGTAGCTGCTTCAGCTTCA GCCACTCGAATTTTCGATATTCCTTTTTATTTCTCATCAAACGAATGGCATCTTCTTCTGGAAATCCTAGCTTTTCTGAG CATGATAGTGGGGAATCTCATTGCTATTACTCAAACAAGCATGAAACGTATGCTTGCATATTCGTCCATAGGTCAAATCG GATATGTAATTATTGGAATAATTGTTGGAGACTCAAATGGTGGATATGCAAGCATGATAACTTATATGCTCTTCTATATC TCCATGAATCTAGGAACTTTTGCTTGTATTGTATTATTTGGTCTACGTACCGGAACTGATAACATTCGAGATTATGCAGG ATTATACACGAAAGATCCTTTTTTGGCTCTCTCTTTAGCCCTATGTCTCTTATCCCTAGGAGGTCTTCCTCCACTAGCAG GTTTTTTCGGAAAACTCCATTTATTCTGGTGTGGATGGCAGGCAGGCCTATATTTCTTGGTTTTAATAGGACTCCTTACG AGCGTTGTTTCTATCTACTATTATCTAAAAATAATCAAGTTATTAATGACTGGACGAAACCAAGAAAGAACCTCTCACGT GCGAAATTATAGAACTTTAAGATCAAACAATTCCATCGAATTGAGTATGATTGTATGTGTGATAGCATCTACTATACCGG GAATATCAATGAACCCGATTATTGAAATTGCTCAAGATACCCTTTTTTA
Product
Source
RefSeq
Link:
JCDBP00064
ID
JCDBP00064
Parent
JCDBR00088
Name
YP_002720157.1
Scaffold
NC_012224.1
CDS
102419-103168,103851-104627
Strand:
-
Sequence
MIWHVQNENFILDSTRIFMKAFHLLLFDGSFIFPECILIFGLILLLMIDSTSDQKDIPWLYFISSTSLVMSITALLFRWR EEPMISFSGNFQTNNFNEIFQFLILLCSTLCIPLSVEYIECTEMAITEFLLFLLTATLGGMFLCGANDLITIFVAPECFS LCSYLLSGYTKKDVRSNEATTKYLLMGGASSSILVHAFSWLYGSSGGEIELQEIVNGLINTQMYNSPGISIALIFITVGI GFKLSPAPSHQWTPDVYEGSPTPVVAFLSVTSKVAASASATRIFDIPFYFSSNEWHLLLEILAFLSMIVGNLIAITQTSM KRMLAYSSIGQIGYVIIGIIVGDSNGGYASMITYMLFYISMNLGTFACIVLFGLRTGTDNIRDYAGLYTKDPFLALSLAL CLLSLGGLPPLAGFFGKLHLFWCGWQAGLYFLVLIGLLTSVVSIYYYLKIIKLLMTGRNQERTSHVRNYRTLRSNNSIEL SMIVCVIASTIPGISMNPIIEIAQDTLF
Product
NADH dehydrogenase subunit 2
Source
RefSeq
Link
YP_002720157.1
InterProScan
IPR001750 NADH:quinone oxidoreductase/Mrp antiporter, membrane subunit
IPR010096 NAD(P)H-quinone oxidoreductase, subunit N/subunit 2
Pfam
PF00361.16 Proton_antipo_M Family