Detail information of JCDBG00089

JCDBG00089
ID
JCDBG00089
Name
rps7
Type
protein_coding
Scaffold
NC_012224.1
Start
104932
End
105399
Strand
-
Link
Genbank id:7564782
Molecular function
GO:0003723 | RNA binding
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0015935 | small ribosomal subunit
Biological process
GO:0006412 | translation
KEGG
Entry: K02992
Name: RP-S7, MRPS7, rpsG
Definition: small subunit ribosomal protein S7
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
CATGTCACGTCGAGGTACTGCAGAAGAAAAAACTGCAAAATCCGATCCAATTTATCGTAATCGATTAGTTAACATGTTGG TTAACCGTATTCTGAAACACGGAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGATTCAACAAAAG ACAGAAACAAATCCACTATCTGTTTTACGTCAAGCAATACGTGGAGTAACTCCCGATATAGCAGTAAAAGCAAGGCGTGT AGGCGGATCGACTCATCAAGTTCCCATTGAAATAGGATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGG CATCCCGAAAACGTCCGGGTCGAAATATGGCTTTCAAATTAAGTTCCGAATTAGTGGATGCTGCAAAAGGGAGTGGTGAT GCCATACGCAAAAAGGAAGAGACTCATAGAATGGCAGAGGCAAATAGAGCTTTTGCACATTTTCGTTA
Gene structure

JCDB Genes gff download

JCDBG00089 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00089's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00089JCDBG00081co-exp0.647066
PPI network
node1node2type
JCDBG00089JCDBG24182PPI
JCDBG00089JCDBG15079PPI
JCDBG00089JCDBG16654PPI
JCDBG00089JCDBG09324PPI
JCDBG00089JCDBG15890PPI
JCDBG00089JCDBG14958PPI
JCDBG00089JCDBG07363PPI
JCDBG00089JCDBG17434PPI
JCDBG00089JCDBG21369PPI
JCDBG00089JCDBG01351PPI
JCDBG00089JCDBG23530PPI
JCDBG00089JCDBG05191PPI
JCDBG00089JCDBG18937PPI
JCDBG00089JCDBG15243PPI
JCDBG00089JCDBG23880PPI
JCDBG00089JCDBG13802PPI
JCDBG00089JCDBG10704PPI
JCDBG00089JCDBG19737PPI
JCDBG00089JCDBG20140PPI
JCDBG00089JCDBG19929PPI
JCDBG00089JCDBG23997PPI
JCDBG00089JCDBG20369PPI
JCDBG00089JCDBG03794PPI
JCDBG00089JCDBG18926PPI
JCDBG00089JCDBG24904PPI
JCDBG00089JCDBG23469PPI
JCDBG00089JCDBG08044PPI
JCDBG00089JCDBG21411PPI
JCDBG00089JCDBG23088PPI
JCDBG00089JCDBG17129PPI
JCDBG00089JCDBG09164PPI
JCDBG00089JCDBG15505PPI
JCDBG00089JCDBG08468PPI
JCDBG00089JCDBG08163PPI
JCDBG00089JCDBG12807PPI
JCDBG00089JCDBG21747PPI
JCDBG00089JCDBG22653PPI
JCDBG00089JCDBG00306PPI
JCDBG00089JCDBG08991PPI
JCDBG00089JCDBG10875PPI
JCDBG00089JCDBG11027PPI
JCDBG00089JCDBG00558PPI
JCDBG00089JCDBG12884PPI
JCDBG00089JCDBG14381PPI
JCDBG00089JCDBG17892PPI
JCDBG00089JCDBG15810PPI
JCDBG00089JCDBG13719PPI
JCDBG00089JCDBG11901PPI
JCDBG00089JCDBG12692PPI
JCDBG00089JCDBG04352PPI
JCDBG00089JCDBG23734PPI
JCDBG00089JCDBG20457PPI
JCDBG00089JCDBG19936PPI
JCDBG00089JCDBG20749PPI
JCDBG00089JCDBG18629PPI
JCDBG00089JCDBG22869PPI
JCDBG00089JCDBG12398PPI
JCDBG00089JCDBG23113PPI
JCDBG00089JCDBG09698PPI
JCDBG00089JCDBG22121PPI
JCDBG00089JCDBG10175PPI
JCDBG00089JCDBG08042PPI
JCDBG00089JCDBG03587PPI
JCDBG00089JCDBG17224PPI
JCDBG24182JCDBG15079PPI
JCDBG24182JCDBG16654PPI
JCDBG24182JCDBG09324PPI
JCDBG24182JCDBG14958PPI
JCDBG24182JCDBG07363PPI
JCDBG24182JCDBG17434PPI
JCDBG24182JCDBG21369PPI
JCDBG24182JCDBG23530PPI
JCDBG24182JCDBG05191PPI
JCDBG24182JCDBG23880PPI
JCDBG24182JCDBG13802PPI
JCDBG24182JCDBG20140PPI
JCDBG24182JCDBG19929PPI
JCDBG24182JCDBG23997PPI
JCDBG24182JCDBG03794PPI
JCDBG24182JCDBG23469PPI
JCDBG24182JCDBG08044PPI
JCDBG24182JCDBG17129PPI
JCDBG24182JCDBG09164PPI
JCDBG24182JCDBG08468PPI
JCDBG24182JCDBG12807PPI
JCDBG24182JCDBG21747PPI
JCDBG24182JCDBG22653PPI
JCDBG24182JCDBG00306PPI
JCDBG24182JCDBG11027PPI
JCDBG24182JCDBG00558PPI
JCDBG24182JCDBG15810PPI
JCDBG24182JCDBG23734PPI
JCDBG24182JCDBG20457PPI
JCDBG24182JCDBG19936PPI
JCDBG24182JCDBG12398PPI
JCDBG24182JCDBG23113PPI
JCDBG24182JCDBG08042PPI
JCDBG24182JCDBG03587PPI
JCDBG15079JCDBG23880PPI
JCDBG16654JCDBG15890PPI
JCDBG16654JCDBG23530PPI
JCDBG16654JCDBG15243PPI
JCDBG16654JCDBG23880PPI
JCDBG16654JCDBG13802PPI
JCDBG16654JCDBG03794PPI
JCDBG16654JCDBG23469PPI
JCDBG16654JCDBG08163PPI
JCDBG16654JCDBG00306PPI
JCDBG16654JCDBG11027PPI
JCDBG16654JCDBG12398PPI
JCDBG16654JCDBG23113PPI
JCDBG16654JCDBG03587PPI
JCDBG09324JCDBG14958PPI
JCDBG09324JCDBG23880PPI
JCDBG09324JCDBG13802PPI
JCDBG09324JCDBG03794PPI
JCDBG09324JCDBG00306PPI
JCDBG09324JCDBG23113PPI
JCDBG15890JCDBG18937PPI
JCDBG14958JCDBG23880PPI
JCDBG14958JCDBG13802PPI
JCDBG14958JCDBG03794PPI
JCDBG14958JCDBG00306PPI
JCDBG14958JCDBG23113PPI
JCDBG07363JCDBG23880PPI
JCDBG07363JCDBG19936PPI
JCDBG17434JCDBG23530PPI
JCDBG17434JCDBG23880PPI
JCDBG17434JCDBG19737PPI
JCDBG17434JCDBG18926PPI
JCDBG17434JCDBG23469PPI
JCDBG17434JCDBG00306PPI
JCDBG17434JCDBG11027PPI
JCDBG17434JCDBG20457PPI
JCDBG17434JCDBG19936PPI
JCDBG17434JCDBG23113PPI
JCDBG21369JCDBG23530PPI
JCDBG21369JCDBG23880PPI
JCDBG21369JCDBG20457PPI
JCDBG21369JCDBG08042PPI
JCDBG23530JCDBG23880PPI
JCDBG23530JCDBG13802PPI
JCDBG23530JCDBG19737PPI
JCDBG23530JCDBG03794PPI
JCDBG23530JCDBG23469PPI
JCDBG23530JCDBG22653PPI
JCDBG23530JCDBG00306PPI
JCDBG23530JCDBG11027PPI
JCDBG23530JCDBG00558PPI
JCDBG23530JCDBG19936PPI
JCDBG23530JCDBG23113PPI
JCDBG23530JCDBG09698PPI
JCDBG23530JCDBG03587PPI
JCDBG05191JCDBG23880PPI
JCDBG05191JCDBG03794PPI
JCDBG05191JCDBG22121PPI
JCDBG18937JCDBG10704PPI
JCDBG18937JCDBG23088PPI
JCDBG18937JCDBG10175PPI
JCDBG18937JCDBG08042PPI
JCDBG15243JCDBG23880PPI
JCDBG15243JCDBG03794PPI
JCDBG15243JCDBG23469PPI
JCDBG15243JCDBG00306PPI
JCDBG15243JCDBG04352PPI
JCDBG15243JCDBG23734PPI
JCDBG15243JCDBG23113PPI
JCDBG23880JCDBG13802PPI
JCDBG23880JCDBG20140PPI
JCDBG23880JCDBG19929PPI
JCDBG23880JCDBG23997PPI
JCDBG23880JCDBG03794PPI
JCDBG23880JCDBG23469PPI
JCDBG23880JCDBG08044PPI
JCDBG23880JCDBG17129PPI
JCDBG23880JCDBG09164PPI
JCDBG23880JCDBG15505PPI
JCDBG23880JCDBG08468PPI
JCDBG23880JCDBG08163PPI
JCDBG23880JCDBG22653PPI
JCDBG23880JCDBG08991PPI
JCDBG23880JCDBG00558PPI
JCDBG23880JCDBG17892PPI
JCDBG23880JCDBG04352PPI
JCDBG23880JCDBG23734PPI
JCDBG23880JCDBG20457PPI
JCDBG23880JCDBG19936PPI
JCDBG23880JCDBG20749PPI
JCDBG23880JCDBG22869PPI
JCDBG23880JCDBG10175PPI
JCDBG23880JCDBG08042PPI
JCDBG23880JCDBG03587PPI
JCDBG13802JCDBG19737PPI
JCDBG13802JCDBG23997PPI
JCDBG13802JCDBG23469PPI
JCDBG13802JCDBG09164PPI
JCDBG13802JCDBG08468PPI
JCDBG13802JCDBG08991PPI
JCDBG13802JCDBG11027PPI
JCDBG13802JCDBG15810PPI
JCDBG13802JCDBG23734PPI
JCDBG13802JCDBG19936PPI
JCDBG13802JCDBG22869PPI
JCDBG13802JCDBG12398PPI
JCDBG13802JCDBG03587PPI
JCDBG10704JCDBG03794PPI
JCDBG10704JCDBG23088PPI
JCDBG19737JCDBG20140PPI
JCDBG19737JCDBG23997PPI
JCDBG19737JCDBG20457PPI
JCDBG20140JCDBG03794PPI
JCDBG20140JCDBG22653PPI
JCDBG20140JCDBG22121PPI
JCDBG19929JCDBG03794PPI
JCDBG23997JCDBG03794PPI
JCDBG23997JCDBG00306PPI
JCDBG23997JCDBG23113PPI
JCDBG20369JCDBG21411PPI
JCDBG20369JCDBG00306PPI
JCDBG20369JCDBG12884PPI
JCDBG20369JCDBG14381PPI
JCDBG20369JCDBG23113PPI
JCDBG20369JCDBG09698PPI
JCDBG03794JCDBG23469PPI
JCDBG03794JCDBG17129PPI
JCDBG03794JCDBG21747PPI
JCDBG03794JCDBG22653PPI
JCDBG03794JCDBG08991PPI
JCDBG03794JCDBG00558PPI
JCDBG03794JCDBG15810PPI
JCDBG03794JCDBG12692PPI
JCDBG03794JCDBG04352PPI
JCDBG03794JCDBG19936PPI
JCDBG03794JCDBG20749PPI
JCDBG03794JCDBG22869PPI
JCDBG03794JCDBG09698PPI
JCDBG03794JCDBG03587PPI
JCDBG18926JCDBG00306PPI
JCDBG18926JCDBG23113PPI
JCDBG23469JCDBG11027PPI
JCDBG23469JCDBG00558PPI
JCDBG23469JCDBG19936PPI
JCDBG23469JCDBG03587PPI
JCDBG08044JCDBG23088PPI
JCDBG08044JCDBG00306PPI
JCDBG08044JCDBG04352PPI
JCDBG08044JCDBG23734PPI
JCDBG08044JCDBG23113PPI
JCDBG08044JCDBG10175PPI
JCDBG21411JCDBG00306PPI
JCDBG21411JCDBG23113PPI
JCDBG23088JCDBG10875PPI
JCDBG23088JCDBG11901PPI
JCDBG23088JCDBG22121PPI
JCDBG09164JCDBG09698PPI
JCDBG09164JCDBG10175PPI
JCDBG08468JCDBG00306PPI
JCDBG08468JCDBG23113PPI
JCDBG08468JCDBG09698PPI
JCDBG08468JCDBG03587PPI
JCDBG08163JCDBG00306PPI
JCDBG08163JCDBG19936PPI
JCDBG08163JCDBG12398PPI
JCDBG08163JCDBG23113PPI
JCDBG21747JCDBG20457PPI
JCDBG22653JCDBG03587PPI
JCDBG00306JCDBG08991PPI
JCDBG00306JCDBG00558PPI
JCDBG00306JCDBG12884PPI
JCDBG00306JCDBG14381PPI
JCDBG00306JCDBG12692PPI
JCDBG00306JCDBG20457PPI
JCDBG00306JCDBG22869PPI
JCDBG00306JCDBG08042PPI
JCDBG00306JCDBG03587PPI
JCDBG08991JCDBG19936PPI
JCDBG08991JCDBG23113PPI
JCDBG00558JCDBG19936PPI
JCDBG00558JCDBG23113PPI
JCDBG12884JCDBG14381PPI
JCDBG12884JCDBG23113PPI
JCDBG14381JCDBG23113PPI
JCDBG14381JCDBG09698PPI
JCDBG12692JCDBG19936PPI
JCDBG12692JCDBG23113PPI
JCDBG04352JCDBG22121PPI
JCDBG20457JCDBG19936PPI
JCDBG20457JCDBG23113PPI
JCDBG19936JCDBG18629PPI
JCDBG19936JCDBG22869PPI
JCDBG19936JCDBG08042PPI
JCDBG22869JCDBG23113PPI
JCDBG23113JCDBG08042PPI
JCDBG23113JCDBG03587PPI
JCDBG09698JCDBG03587PPI
JCDBG22121JCDBG08042PPI
JCDBR00089
ID
JCDBR00089
Name
rps7
Type
protein_coding
Scaffold
NC_012224.1
Start
104932
End
105399
Strand
-
Exon
104932-105399
Sequence
CATGTCACGTCGAGGTACTGCAGAAGAAAAAACTGCAAAATCCGATCCAATTTATCGTAATCGATTAGTTAACATGTTGG TTAACCGTATTCTGAAACACGGAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGATTCAACAAAAG ACAGAAACAAATCCACTATCTGTTTTACGTCAAGCAATACGTGGAGTAACTCCCGATATAGCAGTAAAAGCAAGGCGTGT AGGCGGATCGACTCATCAAGTTCCCATTGAAATAGGATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGG CATCCCGAAAACGTCCGGGTCGAAATATGGCTTTCAAATTAAGTTCCGAATTAGTGGATGCTGCAAAAGGGAGTGGTGAT GCCATACGCAAAAAGGAAGAGACTCATAGAATGGCAGAGGCAAATAGAGCTTTTGCACATTTTCGTTA
Product
Source
RefSeq
Link:
JCDBP00065
ID
JCDBP00065
Parent
JCDBR00089
Name
YP_002720158.1
Scaffold
NC_012224.1
CDS
104932-105399
Strand:
-
Sequence
MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRV GGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR
Product
ribosomal protein S7
Source
RefSeq
Link
YP_002720158.1
InterProScan
IPR000235 Ribosomal protein S5/S7
IPR005717 Ribosomal protein S7, bacterial/organellar-type
IPR020606 Ribosomal protein S7, conserved site
IPR023798 Ribosomal protein S7 domain
Pfam
PF00177.17 Ribosomal_S7 Domain