Detail information of JCDBG00100

JCDBG00100
ID
JCDBG00100
Name
ndhF
Type
protein_coding
Scaffold
NC_012224.1
Start
118957
End
121323
Strand
-
Link
Genbank id:7564793
Molecular function
GO:0008137 | NADH dehydrogenase (ubiquinone) activity
Cellular component
Biological process
GO:0042773 | ATP synthesis coupled electron transport
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05577
Name: ndhF
Definition: NAD(P)H-quinone oxidoreductase subunit 5 [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
TATGGAACATATATATCAATATTCATGGATCATACCTTTCGTTACGTTCACCGTGCCTATATTAATAGGAGCGGGACTCC TACTTTTTCCGGCAGCAACAAAAAAACTTCGTCGTATATGGGTTTTTCCAAGCGTTTTATTGTTAAATATAGTCATGATT TTTTCAATCGATCTGTCTATTCAGCAAATAAATAGCAGTTTTTTATATCAATATATATGGTCGTGGACTATCAATAATGA TTTTTCTTTAGAGTTCGGATACTTGATTGACCCACTTACTTCTATTTTGTCAGTATTAATTACTACAGTTGGAATTTTGG TTCTTTTTTATAGTGATAATTATATGTCTCATGATCAAGGCTATTTGAGATTTTTTGCTTATATGAGTTTTTTCAATACT TCAATGTTGGGATTAGTTACTAGTTCTAATTTGATACAAATTTATATTTTTTGGGAATTGGTTGGAATGTGTTCTTATCT ATTAATAGGTTTTTGGTTCACACGACCTATTGCATCAAACGCTTGTCAAAAAGCGTTTGTAACTAATCGTGTAGGGGATT TTGGTTTATTATTAGGAATTTTAGGTCTTTATTGGATAACAGGCAGTTTCGAATTTCGGGATTTGTTCAAAATATTCAAT AACTTGATTTCTAATAATCAGGTTAATCTTTTATTTGTTACTTTGTGTGCCTTTCTATTATTTTCCGGTGCAATTGCGAA ATCGGCGCAATTTCCTCTTCATGTATGGTTACCGGATGCCATGGAAGGGCCTACTCCTATTTCGGCTCTGATACATGCTG CTACTATGGTAGCGGCGGGGATTTTTCTTATAGCTCGACTTTTTCCTCTTTTTGTAGTCACACCTTACATAATGAATCTA ATCGCTTTGATAGGTATAATAACAGTATTTTTAGGAGCTACTTTAGCTCTTGCTCAAAAAGATATTAAGAGAAGTTTAGC CTATTCTACAATGTCTCAATTGGGTTATATGATGTTAGCTCTAGGTATGGGGTCTTATCGAGTCGCTTTATTTCATTTGA TTACTCATGCCTATTCGAAGGCATTGTTGTTTTTAGGATCTGGATCGATTATTCATTCAATGGAAGCTATTGTTGGTTAT TCTCCAGATAAGAGTCAAAATATGGTTCTGATGGGTGGTTTAACAAAACATATTCCAATTACAAAAACTGCTTTTTTATT AGGAACACTTTCCCTTTGTGGTATTCCACCTTTCGCCTGTTTTTGGTCCAAAGATGAGATTCTTAATGATAGTTGGTTGT ATTCACCTATTTTTGCAATAATAGCTTGTTTCACAGCAGGATTAACTGCATTTTATATGTTTCGGGTTTATTTACTTACT TTTGAAGGACATTTAAATGTTCATTTTCAAAATTACAAAAACAGTTCATTTTATTCAATCTCTTTATGGGGTAAAGAAGA ATCTAAAATGCTTAACAACAATTTTCGTTTATTAGCTTTATCAGCAATGAATAATAATGAAAGGACTTCTTTTTTTTGGA GGAACACATATCAAATTGGCGGTAATTTAAGAAATATGACATGGCCTTTTATTACTATTAAAAATTTTAATACTAAAAGG GTTTTTTCCTATCCCCATGAATCGGATAATACTATGTTACTTCCTATGCTTGTTTTGGTACTATTTACTTTATTTGTTGG AGCCATAGGAATTCCCTTCAATCAATTCAATGAAGAAGGAATGCAGTTGGATATTTTGTCAAAACTTTTAACTCCGTCTT TAAACCTTTTGTACCAAAACCAAAGTGAGTCTGTGGATTGGTATGAATTTGTAACAAATGCCATTTTTTCGGTCAGTATA GCTTTTTTCGGAATATTTATAGCGTCCTTTTTATATAAGCCCGTTTATTCATCGTTACAAAATTGGAATTTCTTTAATTT GTTCACTAAGTTGACTAAAAAGGGTCCTAATAGAATTCTTTGGGACAAAATACTAAATGTGATATATAATTGGTCCTATA ATCGAGGTTACATAGATGCTTTTTATGCAATATCTTTTATTGGGGGTATAAGAAAATTGGCCGAATTAATTCATTTTTTT GATAAAAGAATAATTGATGGAATTATCAATGGAGTCGGTCTTACCAGTTTCTTTGTAGGAGAGGGTATAAAATATGTAGG AAGTGGTCGCATCTCTTCTTATCTCTTATTGTATTTATTTTGTGCATTAATCTTTTTAGTAATTTACTACTTTTTTTCAA TTTGTAAAATTGAAAAAAAATTTCAATTATTTATTATATATTCTTTTATTTATTTTTTTTATTTTACTTTATTTATATTT CTTTTTTTTTTTATTTTCTATTTTTTTTTATTTTCTATTTATATATA
Gene structure

JCDB Genes gff download

JCDBG00100 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00100's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00100JCDBG00042co-exp0.91609
JCDBG00100JCDBG00072co-exp0.887318
JCDBG00100JCDBG00073co-exp0.863882
JCDBG00100JCDBG00076co-exp0.852873
JCDBG00100JCDBG00016co-exp0.848717
JCDBG00100JCDBG00004co-exp0.845048
JCDBG00100JCDBG00015co-exp0.823086
JCDBG00100JCDBG00047co-exp0.821621
JCDBG00100JCDBG00067co-exp0.81633
JCDBG00100JCDBG00011co-exp0.815082
JCDBG00042JCDBG00072co-exp0.888954
JCDBG00042JCDBG00073co-exp0.877775
JCDBG00042JCDBG00076co-exp0.878569
JCDBG00042JCDBG00016co-exp0.87673
JCDBG00042JCDBG00004co-exp0.814407
JCDBG00042JCDBG00015co-exp0.895991
JCDBG00042JCDBG00047co-exp0.899261
JCDBG00042JCDBG00067co-exp0.900122
JCDBG00042JCDBG00011co-exp0.778524
JCDBG00072JCDBG00073co-exp0.777219
JCDBG00072JCDBG00076co-exp0.727517
JCDBG00072JCDBG00016co-exp0.783128
JCDBG00072JCDBG00004co-exp0.826225
JCDBG00072JCDBG00015co-exp0.750358
JCDBG00072JCDBG00047co-exp0.861011
JCDBG00072JCDBG00067co-exp0.876583
JCDBG00072JCDBG00011co-exp0.837624
JCDBG00073JCDBG00076co-exp0.907254
JCDBG00073JCDBG00016co-exp0.842042
JCDBG00073JCDBG00004co-exp0.728283
JCDBG00073JCDBG00015co-exp0.832888
JCDBG00073JCDBG00047co-exp0.698535
JCDBG00073JCDBG00067co-exp0.715937
JCDBG00073JCDBG00011co-exp0.809354
JCDBG00076JCDBG00016co-exp0.885852
JCDBG00076JCDBG00004co-exp0.688581
JCDBG00076JCDBG00015co-exp0.930852
JCDBG00076JCDBG00047co-exp0.714558
JCDBG00076JCDBG00067co-exp0.739997
JCDBG00076JCDBG00011co-exp0.697809
JCDBG00016JCDBG00004co-exp0.672087
JCDBG00016JCDBG00015co-exp0.940419
JCDBG00016JCDBG00047co-exp0.761544
JCDBG00016JCDBG00067co-exp0.758045
JCDBG00016JCDBG00011co-exp0.724041
JCDBG00004JCDBG00015co-exp0.624123
JCDBG00004JCDBG00047co-exp0.839702
JCDBG00004JCDBG00067co-exp0.759114
JCDBG00004JCDBG00011co-exp0.745039
JCDBG00015JCDBG00047co-exp0.758093
JCDBG00015JCDBG00067co-exp0.793527
JCDBG00015JCDBG00011co-exp0.630853
JCDBG00047JCDBG00067co-exp0.923353
JCDBG00047JCDBG00011co-exp0.692492
JCDBG00067JCDBG00011co-exp0.698951
PPI network
node1node2type
JCDBR00099
ID
JCDBR00099
Name
ndhF
Type
protein_coding
Scaffold
NC_012224.1
Start
118957
End
121323
Strand
-
Exon
118957-121323
Sequence
TATGGAACATATATATCAATATTCATGGATCATACCTTTCGTTACGTTCACCGTGCCTATATTAATAGGAGCGGGACTCC TACTTTTTCCGGCAGCAACAAAAAAACTTCGTCGTATATGGGTTTTTCCAAGCGTTTTATTGTTAAATATAGTCATGATT TTTTCAATCGATCTGTCTATTCAGCAAATAAATAGCAGTTTTTTATATCAATATATATGGTCGTGGACTATCAATAATGA TTTTTCTTTAGAGTTCGGATACTTGATTGACCCACTTACTTCTATTTTGTCAGTATTAATTACTACAGTTGGAATTTTGG TTCTTTTTTATAGTGATAATTATATGTCTCATGATCAAGGCTATTTGAGATTTTTTGCTTATATGAGTTTTTTCAATACT TCAATGTTGGGATTAGTTACTAGTTCTAATTTGATACAAATTTATATTTTTTGGGAATTGGTTGGAATGTGTTCTTATCT ATTAATAGGTTTTTGGTTCACACGACCTATTGCATCAAACGCTTGTCAAAAAGCGTTTGTAACTAATCGTGTAGGGGATT TTGGTTTATTATTAGGAATTTTAGGTCTTTATTGGATAACAGGCAGTTTCGAATTTCGGGATTTGTTCAAAATATTCAAT AACTTGATTTCTAATAATCAGGTTAATCTTTTATTTGTTACTTTGTGTGCCTTTCTATTATTTTCCGGTGCAATTGCGAA ATCGGCGCAATTTCCTCTTCATGTATGGTTACCGGATGCCATGGAAGGGCCTACTCCTATTTCGGCTCTGATACATGCTG CTACTATGGTAGCGGCGGGGATTTTTCTTATAGCTCGACTTTTTCCTCTTTTTGTAGTCACACCTTACATAATGAATCTA ATCGCTTTGATAGGTATAATAACAGTATTTTTAGGAGCTACTTTAGCTCTTGCTCAAAAAGATATTAAGAGAAGTTTAGC CTATTCTACAATGTCTCAATTGGGTTATATGATGTTAGCTCTAGGTATGGGGTCTTATCGAGTCGCTTTATTTCATTTGA TTACTCATGCCTATTCGAAGGCATTGTTGTTTTTAGGATCTGGATCGATTATTCATTCAATGGAAGCTATTGTTGGTTAT TCTCCAGATAAGAGTCAAAATATGGTTCTGATGGGTGGTTTAACAAAACATATTCCAATTACAAAAACTGCTTTTTTATT AGGAACACTTTCCCTTTGTGGTATTCCACCTTTCGCCTGTTTTTGGTCCAAAGATGAGATTCTTAATGATAGTTGGTTGT ATTCACCTATTTTTGCAATAATAGCTTGTTTCACAGCAGGATTAACTGCATTTTATATGTTTCGGGTTTATTTACTTACT TTTGAAGGACATTTAAATGTTCATTTTCAAAATTACAAAAACAGTTCATTTTATTCAATCTCTTTATGGGGTAAAGAAGA ATCTAAAATGCTTAACAACAATTTTCGTTTATTAGCTTTATCAGCAATGAATAATAATGAAAGGACTTCTTTTTTTTGGA GGAACACATATCAAATTGGCGGTAATTTAAGAAATATGACATGGCCTTTTATTACTATTAAAAATTTTAATACTAAAAGG GTTTTTTCCTATCCCCATGAATCGGATAATACTATGTTACTTCCTATGCTTGTTTTGGTACTATTTACTTTATTTGTTGG AGCCATAGGAATTCCCTTCAATCAATTCAATGAAGAAGGAATGCAGTTGGATATTTTGTCAAAACTTTTAACTCCGTCTT TAAACCTTTTGTACCAAAACCAAAGTGAGTCTGTGGATTGGTATGAATTTGTAACAAATGCCATTTTTTCGGTCAGTATA GCTTTTTTCGGAATATTTATAGCGTCCTTTTTATATAAGCCCGTTTATTCATCGTTACAAAATTGGAATTTCTTTAATTT GTTCACTAAGTTGACTAAAAAGGGTCCTAATAGAATTCTTTGGGACAAAATACTAAATGTGATATATAATTGGTCCTATA ATCGAGGTTACATAGATGCTTTTTATGCAATATCTTTTATTGGGGGTATAAGAAAATTGGCCGAATTAATTCATTTTTTT GATAAAAGAATAATTGATGGAATTATCAATGGAGTCGGTCTTACCAGTTTCTTTGTAGGAGAGGGTATAAAATATGTAGG AAGTGGTCGCATCTCTTCTTATCTCTTATTGTATTTATTTTGTGCATTAATCTTTTTAGTAATTTACTACTTTTTTTCAA TTTGTAAAATTGAAAAAAAATTTCAATTATTTATTATATATTCTTTTATTTATTTTTTTTATTTTACTTTATTTATATTT CTTTTTTTTTTTATTTTCTATTTTTTTTTATTTTCTATTTATATATA
Product
Source
RefSeq
Link:
JCDBP00066
ID
JCDBP00066
Parent
JCDBR00099
Name
YP_002720159.1
Scaffold
NC_012224.1
CDS
118957-121323
Strand:
-
Sequence
MEHIYQYSWIIPFVTFTVPILIGAGLLLFPAATKKLRRIWVFPSVLLLNIVMIFSIDLSIQQINSSFLYQYIWSWTINND FSLEFGYLIDPLTSILSVLITTVGILVLFYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYL LIGFWFTRPIASNACQKAFVTNRVGDFGLLLGILGLYWITGSFEFRDLFKIFNNLISNNQVNLLFVTLCAFLLFSGAIAK SAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLIARLFPLFVVTPYIMNLIALIGIITVFLGATLALAQKDIKRSLA YSTMSQLGYMMLALGMGSYRVALFHLITHAYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMVLMGGLTKHIPITKTAFLL GTLSLCGIPPFACFWSKDEILNDSWLYSPIFAIIACFTAGLTAFYMFRVYLLTFEGHLNVHFQNYKNSSFYSISLWGKEE SKMLNNNFRLLALSAMNNNERTSFFWRNTYQIGGNLRNMTWPFITIKNFNTKRVFSYPHESDNTMLLPMLVLVLFTLFVG AIGIPFNQFNEEGMQLDILSKLLTPSLNLLYQNQSESVDWYEFVTNAIFSVSIAFFGIFIASFLYKPVYSSLQNWNFFNL FTKLTKKGPNRILWDKILNVIYNWSYNRGYIDAFYAISFIGGIRKLAELIHFFDKRIIDGIINGVGLTSFFVGEGIKYVG SGRISSYLLLYLFCALIFLVIYYFFSICKIEKKFQLFIIYSFIYFFYFTLFIFLFFFIFYFFLFSIYI
Product
NADH dehydrogenase subunit 5
Source
RefSeq
Link
YP_002720159.1
InterProScan
IPR001516 NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminal
IPR001750 NADH:quinone oxidoreductase/Mrp antiporter, membrane subunit
IPR002128 NADH:ubiquinone/plastoquinone oxidoreductase, chloroplast chain 5, C-terminal
IPR003945 NADH-plastoquinone oxidoreductase, chain 5
IPR018393 NADH-plastoquinone oxidoreductase, chain 5 subgroup
Pfam
PF00662.16 Proton_antipo_N Family
PF00361.16 Proton_antipo_M Family
PF01010.15 Proton_antipo_C Family