Detail information of JCDBG00101

JCDBG00101
ID
JCDBG00101
Name
rpl32
Type
protein_coding
Scaffold
NC_012224.1
Start
121972
End
122124
Strand
+
Link
Genbank id:7564794
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0015934 | large ribosomal subunit
Biological process
GO:0006412 | translation
KEGG
Source
RefSeq
TF
Description
Sequence
TGGCAGTTCCAAAAAAGCGTATTTCTATATCAAAAAAGCGTATTCGAAAAAATATTTGGAAAAGGAAGGGATATTGGGTA GTATTGAAAGCTTTTTCATTAGCGAAATCCCTTTCTACAGGTAATTCAAAAAGCTTTTTGTGCGACAAATAAA
Gene structure

JCDB Genes gff download

JCDBG00101 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00100
ID
JCDBR00100
Name
rpl32
Type
protein_coding
Scaffold
NC_012224.1
Start
121972
End
122124
Strand
+
Exon
121972-122124
Sequence
TGGCAGTTCCAAAAAAGCGTATTTCTATATCAAAAAAGCGTATTCGAAAAAATATTTGGAAAAGGAAGGGATATTGGGTA GTATTGAAAGCTTTTTCATTAGCGAAATCCCTTTCTACAGGTAATTCAAAAAGCTTTTTGTGCGACAAATAAA
Product
Source
RefSeq
Link:
JCDBP00067
ID
JCDBP00067
Parent
JCDBR00100
Name
YP_002720160.1
Scaffold
NC_012224.1
CDS
121972-122124
Strand:
+
Sequence
MAVPKKRISISKKRIRKNIWKRKGYWVVLKAFSLAKSLSTGNSKSFLCDK
Product
rpl32
Source
RefSeq
Link
YP_002720160.1
InterProScan
IPR002677 Ribosomal protein L32p
IPR011332 Zinc-binding ribosomal protein
Pfam