Detail information of JCDBG00103

JCDBG00103
ID
JCDBG00103
Name
ccsA
Type
protein_coding
Scaffold
NC_012224.1
Start
123330
End
124304
Strand
+
Link
Genbank id:7564796
Molecular function
GO:0020037 | heme binding
Cellular component
Biological process
GO:0017004 | cytochrome complex assembly
KEGG
Source
RefSeq
TF
Description
Sequence
TGATATTTTCGACTTTAGAACATATATTAACTCATATATCTTTTTCAGTCGTGTCAATTGTAATTACAATTCATTTGATA ACCTTATTAGTCGATGAATTCGTAGAATTATATGATTCGTCAGAAAAGGGCATGATAATTACTTTTTTCTGTATAACAGG ATTATTAGTTACTCGTTGGATTTTTGGGGGACATTTACCATTAAGTGATTTATATGAATCATTAATCTTTCTTTCCTGGG TTTTTTCCATTATTCATATGGTTCCGTATTTTAAAAAACACAAAAATTTTCTAAGCGCAATAACCGCGCCAAGTACTTTT TTTACCCAAGGATTTACTACTTCGGGTCTTTTAACTGACATGCATCACTCCGAAATCTTAGTGCCCGCTCTCCAATCCCA TTGGTTAATGATGCACGTAAGTATGATGATATTGGGCTATGCAGCTCTTTTGTGTGGATCATTATTATCAGTAGCATTTC TAGTAATCACATTTCGAAAAATTATAAGAATTGTTGATAAAAACAATAATTTATTAAATGATTCATTTTCTTTTAGTGAG ATACAATATATGACGGAAAGAAAGAATGTTTTAAGAAATATTTCTTTTCTTTCTTCTACTAATAGGAATTATTACAGGTT TCAATTGATTCAACAATTAGATGACTGGGGTTATCGTATTATAAGTATAGGGTTTATCTTTTTAACCATAGGTATTCTTT CGGGAGCAGTCTGGGCTAATGAAGCGTGGGGATCATATTGGAGTTGGGACCCAAAGGAAACTTGGGCATTTATTACGTGG ACCATATTTGCGATTTATTTTCATACTCGAACAAATAAAAATTTTGAGGATTTAAATTCGGCAATTGTCGCTTTTATCGG TTTTCTTCTAATTTGGATATGTTATTTTGGAGTTAATTTATTAGGAATAGGTTTGCATAGTTATGGTTCATTTACATTAA CAATTAACATCTAAT
Gene structure

JCDB Genes gff download

JCDBG00103 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00103's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00103JCDBG00015co-exp0.826044
JCDBG00103JCDBG00043co-exp0.825906
JCDBG00103JCDBG00014co-exp0.803491
JCDBG00103JCDBG00066co-exp0.80025
JCDBG00103JCDBG00064co-exp0.789889
JCDBG00103JCDBG00017co-exp0.787108
JCDBG00103JCDBG00016co-exp0.779471
JCDBG00103JCDBG00042co-exp0.774638
JCDBG00103JCDBG00029co-exp0.772204
JCDBG00103JCDBG00013co-exp0.758222
JCDBG00015JCDBG00043co-exp0.838211
JCDBG00015JCDBG00014co-exp0.962428
JCDBG00015JCDBG00066co-exp0.817076
JCDBG00015JCDBG00064co-exp0.698302
JCDBG00015JCDBG00017co-exp0.837062
JCDBG00015JCDBG00016co-exp0.940419
JCDBG00015JCDBG00042co-exp0.895991
JCDBG00015JCDBG00029co-exp0.810684
JCDBG00015JCDBG00013co-exp0.801903
JCDBG00043JCDBG00014co-exp0.885746
JCDBG00043JCDBG00066co-exp0.801506
JCDBG00043JCDBG00064co-exp0.912455
JCDBG00043JCDBG00017co-exp0.710908
JCDBG00043JCDBG00016co-exp0.685365
JCDBG00043JCDBG00042co-exp0.744324
JCDBG00043JCDBG00029co-exp0.950823
JCDBG00043JCDBG00013co-exp0.958265
JCDBG00014JCDBG00066co-exp0.856988
JCDBG00014JCDBG00064co-exp0.756636
JCDBG00014JCDBG00017co-exp0.844381
JCDBG00014JCDBG00016co-exp0.880861
JCDBG00014JCDBG00042co-exp0.895739
JCDBG00014JCDBG00029co-exp0.879308
JCDBG00014JCDBG00013co-exp0.863631
JCDBG00066JCDBG00064co-exp0.767701
JCDBG00066JCDBG00017co-exp0.924073
JCDBG00066JCDBG00016co-exp0.814743
JCDBG00066JCDBG00042co-exp0.761356
JCDBG00066JCDBG00029co-exp0.741453
JCDBG00066JCDBG00013co-exp0.788828
JCDBG00064JCDBG00017co-exp0.679246
JCDBG00064JCDBG00029co-exp0.87883
JCDBG00064JCDBG00013co-exp0.907456
JCDBG00017JCDBG00016co-exp0.87755
JCDBG00017JCDBG00042co-exp0.821724
JCDBG00017JCDBG00029co-exp0.678798
JCDBG00017JCDBG00013co-exp0.679238
JCDBG00016JCDBG00042co-exp0.87673
JCDBG00016JCDBG00029co-exp0.65824
JCDBG00016JCDBG00013co-exp0.652062
JCDBG00042JCDBG00029co-exp0.738498
JCDBG00042JCDBG00013co-exp0.680279
JCDBG00029JCDBG00013co-exp0.954387
PPI network
node1node2type
JCDBR00102
ID
JCDBR00102
Name
ccsA
Type
protein_coding
Scaffold
NC_012224.1
Start
123330
End
124304
Strand
+
Exon
123330-124304
Sequence
TGATATTTTCGACTTTAGAACATATATTAACTCATATATCTTTTTCAGTCGTGTCAATTGTAATTACAATTCATTTGATA ACCTTATTAGTCGATGAATTCGTAGAATTATATGATTCGTCAGAAAAGGGCATGATAATTACTTTTTTCTGTATAACAGG ATTATTAGTTACTCGTTGGATTTTTGGGGGACATTTACCATTAAGTGATTTATATGAATCATTAATCTTTCTTTCCTGGG TTTTTTCCATTATTCATATGGTTCCGTATTTTAAAAAACACAAAAATTTTCTAAGCGCAATAACCGCGCCAAGTACTTTT TTTACCCAAGGATTTACTACTTCGGGTCTTTTAACTGACATGCATCACTCCGAAATCTTAGTGCCCGCTCTCCAATCCCA TTGGTTAATGATGCACGTAAGTATGATGATATTGGGCTATGCAGCTCTTTTGTGTGGATCATTATTATCAGTAGCATTTC TAGTAATCACATTTCGAAAAATTATAAGAATTGTTGATAAAAACAATAATTTATTAAATGATTCATTTTCTTTTAGTGAG ATACAATATATGACGGAAAGAAAGAATGTTTTAAGAAATATTTCTTTTCTTTCTTCTACTAATAGGAATTATTACAGGTT TCAATTGATTCAACAATTAGATGACTGGGGTTATCGTATTATAAGTATAGGGTTTATCTTTTTAACCATAGGTATTCTTT CGGGAGCAGTCTGGGCTAATGAAGCGTGGGGATCATATTGGAGTTGGGACCCAAAGGAAACTTGGGCATTTATTACGTGG ACCATATTTGCGATTTATTTTCATACTCGAACAAATAAAAATTTTGAGGATTTAAATTCGGCAATTGTCGCTTTTATCGG TTTTCTTCTAATTTGGATATGTTATTTTGGAGTTAATTTATTAGGAATAGGTTTGCATAGTTATGGTTCATTTACATTAA CAATTAACATCTAAT
Product
Source
RefSeq
Link:
JCDBP00068
ID
JCDBP00068
Parent
JCDBR00102
Name
YP_002720161.1
Scaffold
NC_012224.1
CDS
123330-124304
Strand:
+
Sequence
MIFSTLEHILTHISFSVVSIVITIHLITLLVDEFVELYDSSEKGMIITFFCITGLLVTRWIFGGHLPLSDLYESLIFLSW VFSIIHMVPYFKKHKNFLSAITAPSTFFTQGFTTSGLLTDMHHSEILVPALQSHWLMMHVSMMILGYAALLCGSLLSVAF LVITFRKIIRIVDKNNNLLNDSFSFSEIQYMTERKNVLRNISFLSSTNRNYYRFQLIQQLDDWGYRIISIGFIFLTIGIL SGAVWANEAWGSYWSWDPKETWAFITWTIFAIYFHTRTNKNFEDLNSAIVAFIGFLLIWICYFGVNLLGIGLHSYGSFTL TINI
Product
cytochrome c biogenesis protein
Source
RefSeq
Link
YP_002720161.1
InterProScan
IPR002541 Cytochrome c assembly protein
IPR017562 Cytochrome c-type biogenesis protein CcsA
Pfam
PF01578.16 Cytochrom_C_asm Family