Detail information of JCDBG00104

JCDBG00104
ID
JCDBG00104
Name
ndhD
Type
protein_coding
Scaffold
NC_012224.1
Start
124604
End
126106
Strand
-
Link
Genbank id:7564797
Molecular function
GO:0008137 | NADH dehydrogenase (ubiquinone) activity
GO:0016655 | oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
Cellular component
Biological process
GO:0042773 | ATP synthesis coupled electron transport
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05575
Name: ndhD
Definition: NAD(P)H-quinone oxidoreductase subunit 4 [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
CACGAATTCTTTTCCTTGGTTAACAATACTTGTAGTTTTACCGATATCCGCGGGTTCCTTAATTTTCCTTTTCCCTCATA GAGGAAATAAGGTAATTAGGTGGTATACTTTATGTATATGTGTTTTAGAGCTTCTTTTAATGACTTATGTGTTCTCTTAT TATTTCCAATTGGACGATCCATTAATTCAATTAACAGAAGATTATAAATGGATCAAGTTTTTTGATTTTTACTGGAGATT GGGAATAGATGGATTTTCTTTAGGACCTATTTTATTGACAGGATTTATCACTACTTTAGCTACTTTAGCGGCTCGGCCAA TTAATCGGGATTCCCGATTATTCCATTTTCTGATGTTAGCAATGTATAGTGGTCAAATAGGATTATTTTCTTCTCAAGAT CTTTTACTTTTTTTTATCATGTGGGAGTTAGAATTAATTCCCATTTATCTACTTCTATCAATGTGGGGGGGAAAGAAACG TCTGTATTCAGCTACAAAGTTTATTTTGTATACTGCAGGGGGTTCTGTTTTTTTATTAATGGGAGCTTTGGGTATCGCTT TATATGGTTCCAATGAACCAAGATTCCATTTTGAAATATCAGCCAATCAATCATATCCTGCGGCGCTAGAAATATTTTTC TATATTGGATTTCTTATTGCTTTTGCTGTCAAATCACCGATTATACCCTTACATACATGGTTACCAGACACGCATGGGGA AGCACATTACAGTACTTGTATGCTTCTAGCCGGAATCTTATTAAAAATGGGGGCATATGGATTGATTCGAATCAATATGG GATTCTTACCTCATGCTCATTCTATCTTTTCTCCCTGGTTGATAATAGTAGGCGTAATGCAAATAATCTATGCAGCTTCA ACATCTCCTGGTCAACGAAATTTAAAAAAAAGAATAGCATATTCTTCTGTATCTCATATGGGTTTCATAATTATAGGAAT TTGCTCTATAAGTGATATGGGGCTCAACGGAGCCATTTTACAAATAATATCACATGGATTTATTGGTGCTGCACTTTTTT TCTTGGCAGGAACGGGTTATGATAGAATACGTCGTGTTTATCTTGACGAAATGGGTGGAATGGCTCCCCCAATGCCAAAA ATATTTACGACATTCAGTATCTTATCACTAGCTTCTCTTGCATTACCGGGCATGAGTGGTTTTTTTTCGGAATTGATAGT CTTTTTTGGAATAATTACCGGTCAAAAATATCTTTTAATGTCAAAAATATTAATTACTTTTGTAATGGCAGTTGGAATGA TATTAACTCCTATTTATTTATTATCTATGTTACGCCAGATATTCTATGGGTACAGGCTATTTAATGTCCAAAACTCTTAT TTTTTTGATTCTGGACCGCGAGAGTTATTTGTTTCGATCTCTATCCTTCTGCCTGTAATAGGCATTGGTATTTATCCGGA TTTCGTTTTCTCATTATCAATTGACAAGGTCGAAGCTATTCTATCTAATTATTTTTATAGATA
Gene structure

JCDB Genes gff download

JCDBG00104 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00104's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00104JCDBG00032co-exp0.84154
JCDBG00104JCDBG00046co-exp0.819501
JCDBG00104JCDBG00012co-exp0.801908
JCDBG00104JCDBG07355co-exp0.785349
JCDBG00104JCDBG00112co-exp0.765474
JCDBG00104JCDBG00065co-exp0.760895
JCDBG00104JCDBG00037co-exp0.747648
JCDBG00104JCDBG15758co-exp0.744504
JCDBG00104JCDBG04287co-exp0.742291
JCDBG00104JCDBG19930co-exp0.741274
JCDBG00032JCDBG00046co-exp0.945749
JCDBG00032JCDBG00012co-exp0.935341
JCDBG00032JCDBG07355co-exp0.933694
JCDBG00032JCDBG00112co-exp0.894441
JCDBG00032JCDBG00065co-exp0.899738
JCDBG00032JCDBG00037co-exp0.917854
JCDBG00032JCDBG15758co-exp0.822069
JCDBG00032JCDBG04287co-exp0.877753
JCDBG00032JCDBG19930co-exp0.834994
JCDBG00046JCDBG00012co-exp0.949104
JCDBG00046JCDBG07355co-exp0.936736
JCDBG00046JCDBG00112co-exp0.924872
JCDBG00046JCDBG00065co-exp0.954196
JCDBG00046JCDBG00037co-exp0.956923
JCDBG00046JCDBG15758co-exp0.812888
JCDBG00046JCDBG04287co-exp0.852583
JCDBG00046JCDBG19930co-exp0.834277
JCDBG00012JCDBG07355co-exp0.91033
JCDBG00012JCDBG00112co-exp0.961499
JCDBG00012JCDBG00065co-exp0.946607
JCDBG00012JCDBG00037co-exp0.963833
JCDBG00012JCDBG15758co-exp0.79095
JCDBG00012JCDBG04287co-exp0.85859
JCDBG00012JCDBG19930co-exp0.839279
JCDBG07355JCDBG00112co-exp0.887364
JCDBG07355JCDBG00065co-exp0.934898
JCDBG07355JCDBG00037co-exp0.930475
JCDBG07355JCDBG15758co-exp0.825788
JCDBG07355JCDBG04287co-exp0.911766
JCDBG07355JCDBG19930co-exp0.839398
JCDBG00112JCDBG00065co-exp0.944148
JCDBG00112JCDBG00037co-exp0.958141
JCDBG00112JCDBG15758co-exp0.775328
JCDBG00112JCDBG04287co-exp0.825501
JCDBG00112JCDBG19930co-exp0.821922
JCDBG00065JCDBG00037co-exp0.962165
JCDBG00065JCDBG15758co-exp0.803349
JCDBG00065JCDBG04287co-exp0.836956
JCDBG00065JCDBG19930co-exp0.821665
JCDBG00037JCDBG15758co-exp0.794664
JCDBG00037JCDBG04287co-exp0.864966
JCDBG00037JCDBG19930co-exp0.841069
JCDBG15758JCDBG04287co-exp0.779377
JCDBG15758JCDBG19930co-exp0.810859
JCDBG04287JCDBG19930co-exp0.806021
PPI network
node1node2type
JCDBR00103
ID
JCDBR00103
Name
ndhD
Type
protein_coding
Scaffold
NC_012224.1
Start
124604
End
126106
Strand
-
Exon
124604-126106
Sequence
CACGAATTCTTTTCCTTGGTTAACAATACTTGTAGTTTTACCGATATCCGCGGGTTCCTTAATTTTCCTTTTCCCTCATA GAGGAAATAAGGTAATTAGGTGGTATACTTTATGTATATGTGTTTTAGAGCTTCTTTTAATGACTTATGTGTTCTCTTAT TATTTCCAATTGGACGATCCATTAATTCAATTAACAGAAGATTATAAATGGATCAAGTTTTTTGATTTTTACTGGAGATT GGGAATAGATGGATTTTCTTTAGGACCTATTTTATTGACAGGATTTATCACTACTTTAGCTACTTTAGCGGCTCGGCCAA TTAATCGGGATTCCCGATTATTCCATTTTCTGATGTTAGCAATGTATAGTGGTCAAATAGGATTATTTTCTTCTCAAGAT CTTTTACTTTTTTTTATCATGTGGGAGTTAGAATTAATTCCCATTTATCTACTTCTATCAATGTGGGGGGGAAAGAAACG TCTGTATTCAGCTACAAAGTTTATTTTGTATACTGCAGGGGGTTCTGTTTTTTTATTAATGGGAGCTTTGGGTATCGCTT TATATGGTTCCAATGAACCAAGATTCCATTTTGAAATATCAGCCAATCAATCATATCCTGCGGCGCTAGAAATATTTTTC TATATTGGATTTCTTATTGCTTTTGCTGTCAAATCACCGATTATACCCTTACATACATGGTTACCAGACACGCATGGGGA AGCACATTACAGTACTTGTATGCTTCTAGCCGGAATCTTATTAAAAATGGGGGCATATGGATTGATTCGAATCAATATGG GATTCTTACCTCATGCTCATTCTATCTTTTCTCCCTGGTTGATAATAGTAGGCGTAATGCAAATAATCTATGCAGCTTCA ACATCTCCTGGTCAACGAAATTTAAAAAAAAGAATAGCATATTCTTCTGTATCTCATATGGGTTTCATAATTATAGGAAT TTGCTCTATAAGTGATATGGGGCTCAACGGAGCCATTTTACAAATAATATCACATGGATTTATTGGTGCTGCACTTTTTT TCTTGGCAGGAACGGGTTATGATAGAATACGTCGTGTTTATCTTGACGAAATGGGTGGAATGGCTCCCCCAATGCCAAAA ATATTTACGACATTCAGTATCTTATCACTAGCTTCTCTTGCATTACCGGGCATGAGTGGTTTTTTTTCGGAATTGATAGT CTTTTTTGGAATAATTACCGGTCAAAAATATCTTTTAATGTCAAAAATATTAATTACTTTTGTAATGGCAGTTGGAATGA TATTAACTCCTATTTATTTATTATCTATGTTACGCCAGATATTCTATGGGTACAGGCTATTTAATGTCCAAAACTCTTAT TTTTTTGATTCTGGACCGCGAGAGTTATTTGTTTCGATCTCTATCCTTCTGCCTGTAATAGGCATTGGTATTTATCCGGA TTTCGTTTTCTCATTATCAATTGACAAGGTCGAAGCTATTCTATCTAATTATTTTTATAGATA
Product
Source
RefSeq
Link:
JCDBP00069
ID
JCDBP00069
Parent
JCDBR00103
Name
YP_002720162.1
Scaffold
NC_012224.1
CDS
124604-126106
Strand:
-
Sequence
MNSFPWLTILVVLPISAGSLIFLFPHRGNKVIRWYTLCICVLELLLMTYVFSYYFQLDDPLIQLTEDYKWIKFFDFYWRL GIDGFSLGPILLTGFITTLATLAARPINRDSRLFHFLMLAMYSGQIGLFSSQDLLLFFIMWELELIPIYLLLSMWGGKKR LYSATKFILYTAGGSVFLLMGALGIALYGSNEPRFHFEISANQSYPAALEIFFYIGFLIAFAVKSPIIPLHTWLPDTHGE AHYSTCMLLAGILLKMGAYGLIRINMGFLPHAHSIFSPWLIIVGVMQIIYAASTSPGQRNLKKRIAYSSVSHMGFIIIGI CSISDMGLNGAILQIISHGFIGAALFFLAGTGYDRIRRVYLDEMGGMAPPMPKIFTTFSILSLASLALPGMSGFFSELIV FFGIITGQKYLLMSKILITFVMAVGMILTPIYLLSMLRQIFYGYRLFNVQNSYFFDSGPRELFVSISILLPVIGIGIYPD FVFSLSIDKVEAILSNYFYR
Product
NADH dehydrogenase subunit 4
Source
RefSeq
Link
YP_002720162.1
InterProScan
IPR001750 NADH:quinone oxidoreductase/Mrp antiporter, membrane subunit
IPR003918 NADH:ubiquinone oxidoreductase
IPR010227 NADH-quinone oxidoreductase, chain M/4
IPR022997 NADH-quinone oxidoreductase chain 4
Pfam
PF00361.16 Proton_antipo_M Family