Detail information of JCDBG00105

JCDBG00105
ID
JCDBG00105
Name
psaC
Type
protein_coding
Scaffold
NC_012224.1
Start
126256
End
126501
Strand
-
Link
Genbank id:7564798
Molecular function
GO:0009055 | electron carrier activity
GO:0051539 | 4 iron, 4 sulfur cluster binding
Cellular component
GO:0042651 | thylakoid membrane
GO:0009522 | photosystem I
Biological process
GO:0009773 | photosynthetic electron transport in photosystem I
GO:0015979 | photosynthesis
KEGG
Entry: K02691
Name: psaC
Definition: photosystem I subunit VII
ko00195:   Photosynthesis
Source
RefSeq
TF
Description
Sequence
AATGTCACATTCAGTAAAGATTTATGATACATGTATAGGGTGTACTCAATGTGTCCGAGCCTGTCCCACCGATGTATTAG AAATGATACCTTGGGATGGATGTAAATCTAAGCAAATTGCTTCTGCTCCAAGAACAGAGGACTGCGTTGGTTGTAAGAGA TGCGAATCCGCCTGTCCAACAGATTTCTTGAGTGTTCGAGTTTATTTATGGCATGAAACAACTCGAAGCATGGGTCTAGC TTATTG
Gene structure

JCDB Genes gff download

JCDBG00105 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00104
ID
JCDBR00104
Name
psaC
Type
protein_coding
Scaffold
NC_012224.1
Start
126256
End
126501
Strand
-
Exon
126256-126501
Sequence
AATGTCACATTCAGTAAAGATTTATGATACATGTATAGGGTGTACTCAATGTGTCCGAGCCTGTCCCACCGATGTATTAG AAATGATACCTTGGGATGGATGTAAATCTAAGCAAATTGCTTCTGCTCCAAGAACAGAGGACTGCGTTGGTTGTAAGAGA TGCGAATCCGCCTGTCCAACAGATTTCTTGAGTGTTCGAGTTTATTTATGGCATGAAACAACTCGAAGCATGGGTCTAGC TTATTG
Product
Source
RefSeq
Link:
JCDBP00070
ID
JCDBP00070
Parent
JCDBR00104
Name
YP_002720163.1
Scaffold
NC_012224.1
CDS
126256-126501
Strand:
-
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKSKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLA Y
Product
photosystem I subunit VII
Source
RefSeq
Link
YP_002720163.1
InterProScan
IPR017491 Photosystem I protein PsaC
IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
IPR017900 4Fe-4S ferredoxin, iron-sulphur binding, conserved site
Pfam
PF14697.2 Fer4_21 Domain