Detail information of JCDBG00106

JCDBG00106
ID
JCDBG00106
Name
ndhE
Type
protein_coding
Scaffold
NC_012224.1
Start
126758
End
127063
Strand
-
Link
Genbank id:7564799 | Jatropha Genome Database ID:Jcr4U28949.10
Molecular function
GO:0016651 | oxidoreductase activity, acting on NAD(P)H
Cellular component
Biological process
GO:0042773 | ATP synthesis coupled electron transport
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05576
Name: ndhE
Definition: NAD(P)H-quinone oxidoreductase subunit 4L [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
AATGATGCTCGAACATGTACTTGTTTTGAGTGCCTATTTATTTTCTATCGGTATCTATGGATTGATCACGAGTCGAAATA TGGTTAGAGCCCTTATGTGCCTTGAACTTATACTGAATGCAGTTAATATAAATTTCGTAACATTTTCTGATTTTTTTGAT AGTCGCCAACTAAAGGGAAATATTTTTTCAATTTTTGTTATAGCTATCGCAGCCGCTGAAGCAGCTATTGGACCAGCTAT TGTTTCATCAATTTATCGTAACAGAAAATCAACCCGTATCAATCAATCGAATTTGTTGAATAAGTA
Gene structure

JCDB Genes gff download

JCDBG00106 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00105
ID
JCDBR00105
Name
ndhE
Type
protein_coding
Scaffold
NC_012224.1
Start
126758
End
127063
Strand
-
Exon
126758-127063
Sequence
AATGATGCTCGAACATGTACTTGTTTTGAGTGCCTATTTATTTTCTATCGGTATCTATGGATTGATCACGAGTCGAAATA TGGTTAGAGCCCTTATGTGCCTTGAACTTATACTGAATGCAGTTAATATAAATTTCGTAACATTTTCTGATTTTTTTGAT AGTCGCCAACTAAAGGGAAATATTTTTTCAATTTTTGTTATAGCTATCGCAGCCGCTGAAGCAGCTATTGGACCAGCTAT TGTTTCATCAATTTATCGTAACAGAAAATCAACCCGTATCAATCAATCGAATTTGTTGAATAAGTA
Product
Source
RefSeq
Link:
JCDBP00071
ID
JCDBP00071
Parent
JCDBR00105
Name
YP_002720164.1
Scaffold
NC_012224.1
CDS
126758-127063
Strand:
-
Sequence
MMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGNIFSIFVIAIAAAEAAIGPAI VSSIYRNRKSTRINQSNLLNK
Product
NADH dehydrogenase subunit 4L
Source
RefSeq
Link
YP_002720164.1
InterProScan
IPR001133 NADH-ubiquinone oxidoreductase chain 4L/K
Pfam
PF00420.20 Oxidored_q2 Family