Detail information of JCDBG00107

JCDBG00107
ID
JCDBG00107
Name
ndhG
Type
protein_coding
Scaffold
NC_012224.1
Start
127302
End
127832
Strand
-
Link
Genbank id:7564800
Molecular function
GO:0008137 | NADH dehydrogenase (ubiquinone) activity
Cellular component
Biological process
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05578
Name: ndhG
Definition: NAD(P)H-quinone oxidoreductase subunit 6 [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
AATGGATTTGCCTGGACTAATACATGATTTTCTTTTAGTCTTTCTGGGATTAGGTCTTATATTAGGAGGTCTAGGAGTGG TATTATTTACCAATCCAATTTATTCTGCTTTTTCGTTGGGATTTGTTCTTGTTTGTATATCTTTATTCTATATTTTATCA AACTCTCATTTTGTAGCTGCTGCACAGCTCCTTATTTATGTGGGAGCTATAAATGTTTTAATTCTATTTGCCGTGATGTT CATGAATGGTTCAGAATATTACAAAGATTTTAATCTTTGGACTGTTGGAAACGGGGTTACTTCCTTAGTTTGTACAAGCA TTTTTATTTCACTAATTACTATTATTTCAGATACATCATGGTACGGGATTATTTGGACTACAAGAACAAATCAGATTATA GAACAAGATTTAATAAGTAATGGGCAACAAATTGGAATTCATTTATCAACAGATTTTTTTCTTCCATTTGACTTTATTTC AGTAATTCTTTTAGTTGCTTTGATAGGTGCGATTGCTGTGGCTCGTCAGTA
Gene structure

JCDB Genes gff download

JCDBG00107 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00106
ID
JCDBR00106
Name
ndhG
Type
protein_coding
Scaffold
NC_012224.1
Start
127302
End
127832
Strand
-
Exon
127302-127832
Sequence
AATGGATTTGCCTGGACTAATACATGATTTTCTTTTAGTCTTTCTGGGATTAGGTCTTATATTAGGAGGTCTAGGAGTGG TATTATTTACCAATCCAATTTATTCTGCTTTTTCGTTGGGATTTGTTCTTGTTTGTATATCTTTATTCTATATTTTATCA AACTCTCATTTTGTAGCTGCTGCACAGCTCCTTATTTATGTGGGAGCTATAAATGTTTTAATTCTATTTGCCGTGATGTT CATGAATGGTTCAGAATATTACAAAGATTTTAATCTTTGGACTGTTGGAAACGGGGTTACTTCCTTAGTTTGTACAAGCA TTTTTATTTCACTAATTACTATTATTTCAGATACATCATGGTACGGGATTATTTGGACTACAAGAACAAATCAGATTATA GAACAAGATTTAATAAGTAATGGGCAACAAATTGGAATTCATTTATCAACAGATTTTTTTCTTCCATTTGACTTTATTTC AGTAATTCTTTTAGTTGCTTTGATAGGTGCGATTGCTGTGGCTCGTCAGTA
Product
Source
RefSeq
Link:
JCDBP00072
ID
JCDBP00072
Parent
JCDBR00106
Name
YP_002720165.1
Scaffold
NC_012224.1
CDS
127302-127832
Strand:
-
Sequence
MDLPGLIHDFLLVFLGLGLILGGLGVVLFTNPIYSAFSLGFVLVCISLFYILSNSHFVAAAQLLIYVGAINVLILFAVMF MNGSEYYKDFNLWTVGNGVTSLVCTSIFISLITIISDTSWYGIIWTTRTNQIIEQDLISNGQQIGIHLSTDFFLPFDFIS VILLVALIGAIAVARQ
Product
NADH dehydrogenase subunit 6
Source
RefSeq
Link
YP_002720165.1
InterProScan
IPR001457 NADH:ubiquinone/plastoquinone oxidoreductase, chain 6
Pfam
PF00499.16 Oxidored_q3 Family