Detail information of JCDBG00108

JCDBG00108
ID
JCDBG00108
Name
ndhI
Type
protein_coding
Scaffold
NC_012224.1
Start
128386
End
128898
Strand
-
Link
Genbank id:7564801
Molecular function
GO:0016651 | oxidoreductase activity, acting on NAD(P)H
GO:0051539 | 4 iron, 4 sulfur cluster binding
GO:0008137 | NADH dehydrogenase (ubiquinone) activity
Cellular component
GO:0016020 | membrane
Biological process
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05580
Name: ndhI
Definition: NAD(P)H-quinone oxidoreductase subunit I [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
TATGTTTCCTATGGTAACTGGGTTCATGAATTATGGGCAACAAACCATGCAAGCTGCAAGGTACATTGGTCAAGGTTTCA TGATTACCTTATCCCATGCAAACCGTTTACCTGTAACGATTCAATATCCTTATGAAAAATTAATCACATCGGAGCGTTTC CGCGGTCGAATCCATTTTGAATTTGATAAATGCATTGCTTGTGAAGTATGTGTTCGGGTATGCCCTATAGATCTACCTGT TGTTGATTGGCAATTGGAAACTGACATTCGAAAGAAACGGTTGCTTAATTACAGTATCGATTTTGGAATCTGTATATTTT GTGGCAACTGTGTTGAGTATTGTCCAACAAATTGTTTATCAATGACTGAAGAATATGAACTTTCTACTTATGATCGTCAC GAATTGAATTATAATCAAATTGCTTTAGGTCGTTTACCAATGTCAGTAGTTGACGATTATACAATTCGAACAATTTTGAA TTCAACTCAACAAAAAATCAACAAAAAAAAATA
Gene structure

JCDB Genes gff download

JCDBG00108 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00108's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00108JCDBG03899co-exp0.697658
JCDBG00108JCDBG12022co-exp0.697658
JCDBG00108JCDBG22358co-exp0.697658
JCDBG00108JCDBG12179co-exp0.629274
JCDBG00108JCDBG22824co-exp0.606587
JCDBG03899JCDBG12022co-exp1
JCDBG03899JCDBG22358co-exp1
JCDBG12022JCDBG22358co-exp1
PPI network
node1node2type
JCDBG00108JCDBG01459PPI
JCDBG00108JCDBG00700PPI
JCDBR00107
ID
JCDBR00107
Name
ndhI
Type
protein_coding
Scaffold
NC_012224.1
Start
128386
End
128898
Strand
-
Exon
128386-128898
Sequence
TATGTTTCCTATGGTAACTGGGTTCATGAATTATGGGCAACAAACCATGCAAGCTGCAAGGTACATTGGTCAAGGTTTCA TGATTACCTTATCCCATGCAAACCGTTTACCTGTAACGATTCAATATCCTTATGAAAAATTAATCACATCGGAGCGTTTC CGCGGTCGAATCCATTTTGAATTTGATAAATGCATTGCTTGTGAAGTATGTGTTCGGGTATGCCCTATAGATCTACCTGT TGTTGATTGGCAATTGGAAACTGACATTCGAAAGAAACGGTTGCTTAATTACAGTATCGATTTTGGAATCTGTATATTTT GTGGCAACTGTGTTGAGTATTGTCCAACAAATTGTTTATCAATGACTGAAGAATATGAACTTTCTACTTATGATCGTCAC GAATTGAATTATAATCAAATTGCTTTAGGTCGTTTACCAATGTCAGTAGTTGACGATTATACAATTCGAACAATTTTGAA TTCAACTCAACAAAAAATCAACAAAAAAAAATA
Product
Source
RefSeq
Link:
JCDBP00073
ID
JCDBP00073
Parent
JCDBR00107
Name
YP_002720166.1
Scaffold
NC_012224.1
CDS
128386-128898
Strand:
-
Sequence
MFPMVTGFMNYGQQTMQAARYIGQGFMITLSHANRLPVTIQYPYEKLITSERFRGRIHFEFDKCIACEVCVRVCPIDLPV VDWQLETDIRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTEEYELSTYDRHELNYNQIALGRLPMSVVDDYTIRTILN STQQKINKKK
Product
NADH dehydrogenase subunit I
Source
RefSeq
Link
YP_002720166.1
InterProScan
IPR004497 NADH-plastoquinone oxidoreductase, subunit I
IPR010226 NADH-quinone oxidoreductase, chain I
IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
IPR017900 4Fe-4S ferredoxin, iron-sulphur binding, conserved site
Pfam
PF13237.2 Fer4_10 Domain