Detail information of JCDBG00109

JCDBG00109
ID
JCDBG00109
Name
ndhA
Type
protein_coding
Scaffold
NC_012224.1
Start
128980
End
131206
Strand
-
Link
Genbank id:7564802
Molecular function
Cellular component
GO:0016020 | membrane
Biological process
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05572
Name: ndhA
Definition: NAD(P)H-quinone oxidoreductase subunit 1 [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
AATGATAATTGATACAACAGAAGTACAAGCTATCAATTCTTTTTCTAGATTAGAATCCTTAAACGAGGTCTATGGACTTC TATGGGCCTTTGTCCCTATTTTGATTCTTGTATTTGGAATCACGATAGGCATACTAGTAATTGTATGGTTAGAAAGAGAA ATATCTGCAGGGATACAACAACGTATTGGACCTGAATATGCCGGTCCTTTAGGGGTTCTTCAAGCTCTAGCGGATGGGAC AAAACTTCTTTTCAAAGAGAATCTTTTTCCATCTAGGGGAGATACTCGTTTATTCAGTATCGGACCATCCATAGCAGTCA TATCAACTTTATTAAGCTATTCAGTAATTCCTTTTGGCTATCACTTTGTTTTAACTGATCTAAATATTGGTGTTTTTTTA TGGATTGCCATTTCAAGTATTGCTCCCATTGGACTTCTTATGTCAGGATATGGATCCAATAATAAATATTCTTTTTTAGG TGGTCTACGAGCTGCTGCTCAATCGATTAGTTATGAAATACCATTAAGTCTTTGTGTGTTATCCATATCTCTACGTGTGA TTCGTTGAAACATAAATTTTTCCCTATTCTTTTTAGGACTTTTTAGGAAAAGGGCGAAATGAATAGATATCTTCATTTTT TATTCATCATTTGGGTTGATGAACTAAATTGGATAGTTATATGAGTAAAAGAAAACAACTTCGAAATTTGAAGTAAAAAA TGGAGACTCATTTCCTATGTACAAGAGTAAAACAGAAAAAAAAAGAAGACCGGTTGCCCCAAGATTGGTTGATTAGTCAT CCTGACTTGAAGCGGGCTCAAAAGATCAACCTTGTTGAGTTTTCTTGAGTTTTCACTATCATTTATATGTATTACCATAA TTCTAACAGGTGATTAAGCAAAAATGAGTGGATGGTTAGGAATACCAAGATACACAAAGGATTAGTAATAGATTGAAAAT TATCTAAATTATCTACAAAGGGTATTTCGGCCTAATTCGGCCTAATAGATAATAGAAAAGTATATTAATTGGGGCTTTAA GTTGGTAGAAATGATCAGGTAGTACTCCCCATGATTCCGATCCAGAGTATGCTCCTACCCACCGATTAAAGAAATAACTA TCAGGAACGAAATAATCCTTTCATTTTTTTAATCCCCCTTTTTCTTTTTTTTCAGAAAGAAGAATAGGAACGAAAAAAAA GAAATATTTTTTATTCTTTTTTTCTATATCAATATTCATAAAGATGGAATTCGTGTCATAATTCAGAATATCTAACTTTT TCGTAATCGAAAATGATAGGTTGAAATATCTATTGGTATTTTTATAAGGAATATTTTCCTTTTTACAAAGAGTATTTTAT CGAAGGATTTAAGTTATTACTTAAAAAGAAAAATTGAATAAAGGATGAGATCAATTCAGAAGTACTTTTTTATTTTTAGT ATTATAACAGATAGAATTTCGTTGCTCGAATTTTGGAACGTCGAAAGATTTGATTTTGATCCTATCTATTCTATAACTAT TCTATAATATAAACATTCTATAAATATATCAAAATAAATAATATCAAAATAAATAATACGCTCTGATCCTTAAATTTATT TATAGCTTTCGAGGAGCCGTATGAGGTGAGAATCTCATGTACGGTTCTGTAATAGCGATGGGAACAGTGATGTTATCACC GACTATAATTATCTAACAGTTCAAGTACCGTTGATATAGTTGAGGCACAATCAAAATACGGTTTTTGGGGGTGGAATTTG TGGCGTCAACCTATAGGATTTATCATTTTTTTTATTTCTTCTCTAGCAGAGTGTGAAAGATTGCCTTTTGATTTACCAGA AGCAGAAGAAGAATTAGTAGCAGGCTATCAAACCGAATATTCTGGTATAAAATTTGGTTTATTTTATATTGCTTCCTATC TAAACTTATTAGTTTCTTCATTATTTGTAACAGTTCTTTACTTGGGTGGTTGGAATATCCCTATTTCGTATCTATTCGTT CCTGAGCTTTTTCAAATAAATAAAATAGGTGGAGTCTTTGAAACAACAATAGGTATCTTTATTACATTGGTTAAAACTTA TTTGTTCTTGTTCATTCCTATTACAACAAGATGGACTTTACCTAGACTAAGAATGGACCAACTTTTAAATCTTGGATGGA AATTTCTTTTACCTATTTCTCTCGGTAATTTATTATTAACAACCTCTTTCCAACTCCTTTCACTATA
Gene structure

JCDB Genes gff download

JCDBG00109 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00108
ID
JCDBR00108
Name
ndhA
Type
protein_coding
Scaffold
NC_012224.1
Start
128980
End
131206
Strand
-
Exon
128980-129519,130655-131206
Sequence
AATGATAATTGATACAACAGAAGTACAAGCTATCAATTCTTTTTCTAGATTAGAATCCTTAAACGAGGTCTATGGACTTC TATGGGCCTTTGTCCCTATTTTGATTCTTGTATTTGGAATCACGATAGGCATACTAGTAATTGTATGGTTAGAAAGAGAA ATATCTGCAGGGATACAACAACGTATTGGACCTGAATATGCCGGTCCTTTAGGGGTTCTTCAAGCTCTAGCGGATGGGAC AAAACTTCTTTTCAAAGAGAATCTTTTTCCATCTAGGGGAGATACTCGTTTATTCAGTATCGGACCATCCATAGCAGTCA TATCAACTTTATTAAGCTATTCAGTAATTCCTTTTGGCTATCACTTTGTTTTAACTGATCTAAATATTGGTGTTTTTTTA TGGATTGCCATTTCAAGTATTGCTCCCATTGGACTTCTTATGTCAGGATATGGATCCAATAATAAATATTCTTTTTTAGG TGGTCTACGAGCTGCTGCTCAATCGATTAGTTATGAAATACCATTAAGTCTTTGTGTGTTATCCATATCTCTACGTGTGA TTCGTTGAAACATAAATTTTTCCCTATTCTTTTTAGGACTTTTTAGGAAAAGGGCGAAATGAATAGATATCTTCATTTTT TATTCATCATTTGGGTTGATGAACTAAATTGGATAGTTATATGAGTAAAAGAAAACAACTTCGAAATTTGAAGTAAAAAA TGGAGACTCATTTCCTATGTACAAGAGTAAAACAGAAAAAAAAAGAAGACCGGTTGCCCCAAGATTGGTTGATTAGTCAT CCTGACTTGAAGCGGGCTCAAAAGATCAACCTTGTTGAGTTTTCTTGAGTTTTCACTATCATTTATATGTATTACCATAA TTCTAACAGGTGATTAAGCAAAAATGAGTGGATGGTTAGGAATACCAAGATACACAAAGGATTAGTAATAGATTGAAAAT TATCTAAATTATCTACAAAGGGTATTTCGGCCTAATTCGGCCTAATAGATAATAGAAAAGTATATTAATTGGGGCTTTAA GTTGGTAGAAATGATCAGGTAGTACTCCCCATGATTCCGATCCAGAGTATGCTCCTACCCACCGATTAAAGAAATAACTA TCAGGAACGAAATAATCCTTTCATTTTTTTAATCCCCCTTTTTCTTTTTTTTCAGAAAGAAGAATAGGAACGAAAAAAAA GAAATATTTTTTATTCTTTTTTTCTATATCAATATTCATAAAGATGGAATTCGTGTCATAATTCAGAATATCTAACTTTT TCGTAATCGAAAATGATAGGTTGAAATATCTATTGGTATTTTTATAAGGAATATTTTCCTTTTTACAAAGAGTATTTTAT CGAAGGATTTAAGTTATTACTTAAAAAGAAAAATTGAATAAAGGATGAGATCAATTCAGAAGTACTTTTTTATTTTTAGT ATTATAACAGATAGAATTTCGTTGCTCGAATTTTGGAACGTCGAAAGATTTGATTTTGATCCTATCTATTCTATAACTAT TCTATAATATAAACATTCTATAAATATATCAAAATAAATAATATCAAAATAAATAATACGCTCTGATCCTTAAATTTATT TATAGCTTTCGAGGAGCCGTATGAGGTGAGAATCTCATGTACGGTTCTGTAATAGCGATGGGAACAGTGATGTTATCACC GACTATAATTATCTAACAGTTCAAGTACCGTTGATATAGTTGAGGCACAATCAAAATACGGTTTTTGGGGGTGGAATTTG TGGCGTCAACCTATAGGATTTATCATTTTTTTTATTTCTTCTCTAGCAGAGTGTGAAAGATTGCCTTTTGATTTACCAGA AGCAGAAGAAGAATTAGTAGCAGGCTATCAAACCGAATATTCTGGTATAAAATTTGGTTTATTTTATATTGCTTCCTATC TAAACTTATTAGTTTCTTCATTATTTGTAACAGTTCTTTACTTGGGTGGTTGGAATATCCCTATTTCGTATCTATTCGTT CCTGAGCTTTTTCAAATAAATAAAATAGGTGGAGTCTTTGAAACAACAATAGGTATCTTTATTACATTGGTTAAAACTTA TTTGTTCTTGTTCATTCCTATTACAACAAGATGGACTTTACCTAGACTAAGAATGGACCAACTTTTAAATCTTGGATGGA AATTTCTTTTACCTATTTCTCTCGGTAATTTATTATTAACAACCTCTTTCCAACTCCTTTCACTATA
Product
Source
RefSeq
Link:
JCDBP00074
ID
JCDBP00074
Parent
JCDBR00108
Name
YP_002720167.1
Scaffold
NC_012224.1
CDS
128980-129519,130655-131206
Strand:
-
Sequence
MIIDTTEVQAINSFSRLESLNEVYGLLWAFVPILILVFGITIGILVIVWLEREISAGIQQRIGPEYAGPLGVLQALADGT KLLFKENLFPSRGDTRLFSIGPSIAVISTLLSYSVIPFGYHFVLTDLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLG GLRAAAQSISYEIPLSLCVLSISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIIFFISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYIASYLNLLVSSLFVTVLYLGGWNIPISYLFVPELFQINKIGGVFETTIGIFITLVKTYLFLFI PITTRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSFQLLSL
Product
NADH dehydrogenase subunit 1
Source
RefSeq
Link
YP_002720167.1
InterProScan
IPR001694 NADH:ubiquinone oxidoreductase, subunit 1/F420H2 oxidoreductase subunit H
IPR018086 NADH:ubiquinone oxidoreductase, subunit 1, conserved site
Pfam
PF00146.17 NADHdh Family