Detail information of JCDBG00110

JCDBG00110
ID
JCDBG00110
Name
ndhH
Type
protein_coding
Scaffold
NC_012224.1
Start
131208
End
132389
Strand
-
Link
Genbank id:7564803
Molecular function
GO:0016651 | oxidoreductase activity, acting on NAD(P)H
GO:0051287 | NAD binding
GO:0048038 | quinone binding
Cellular component
Biological process
GO:0055114 | oxidation-reduction process
KEGG
Entry: K05579
Name: ndhH
Definition: NAD(P)H-quinone oxidoreductase subunit H [EC:1.6.5.3]
ko00190:   Oxidative phosphorylation
Source
RefSeq
TF
Description
Sequence
TATGAATGTACCAGCTATGCGAAAAGACCTTATGATAGTCAATATGGGTCCCCACCACCCATCAATGCATGGTGTTCTTC GACTCATCGTTACTCTAGATGGCGAAGATGTTATTGACTGTGAACCAATATTAGGTTATTTACACAGAGGCATGGAAAAA ATTGCGGAAAATCGAACAATTATACAATATTTGCCCTATGTAACACGTTGGGATTATTTGGCTACTATGTTCACAGAAGC AATAACAGTAAATGGCCCAGAACTGTTAGGAAATATTCAAGTGCCTAAAAGAGCTAGCTATATCAGGGTAATTATGTTGG AATTGAGTCGTATAGCTTCTCATTTATTATGGCTTGGCCCTTTTATGGCGGATATTGGGGCACAGACTCCTTTCTTCTAT ATTTTTAGAGAGAGAGAGTTAGTATATGATTTATTCGAAGCTGCCACTGGTATGAGAATGATGCATAATTATTTTCGTAT TGGGGGAGTAGCGGCTGATCTACCTCATGGCTGGATAGATAAATGTTTGGATTTTTGTGATTATTTTTTAACAAGAGTTG CTGAATATCAAAAACTTATTACGCGAAATCCTATTTTTTTAGAACGAGTTGAAGGAGTTGGTATTGTTGGTACAGAGGAA GCAATAAATTGGGGGTTATCAGGACCAATGCTACGAGCTTCCGGAGTACAATGGGATCTTCGTAAAATGGATCGTTATGA GTGTTACGACGAATTTGATTGGGAAGTCCAGTGGCAAAAAGAAGGGGATTCATTAGCTCGTTATTTAGTCCGAATTGGTG AAACGATGGAATCTATAAAAATTATTCAACAGGCTCTGGAAGGAATTCCGGGGGGGCCCTATGAAAATTTAGAAACCCGA CGTTTTGATAAAGAAGGGGATCCAGAATGGAACGATTTCGAATATCGATTCATTAGTAAAAGAACTTCTCCTACTTTTGA ATTACCGAAACAAGAACTTTATGTGAGAGTCGAAGCTCCAAAAGGAGAATTGGGAATTTTTCTGATAGGGGATCAGAGCG GTTTTCCTTGGAGATGGAAAATTCGCCCCCCGGGTTTTATCAATTTGCAAATTCTTCCTCAATTAGTTAAAAGAATGAAA TTGGCTGATATTATGACAATACTAGGTAGTATAGATATCATTATGGGAGAAGTTGATCGTTG
Gene structure

JCDB Genes gff download

JCDBG00110 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00110's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
PPI network
node1node2type
JCDBG00110JCDBG20204PPI
JCDBG00110JCDBG13158PPI
JCDBR00109
ID
JCDBR00109
Name
ndhH
Type
protein_coding
Scaffold
NC_012224.1
Start
131208
End
132389
Strand
-
Exon
131208-132389
Sequence
TATGAATGTACCAGCTATGCGAAAAGACCTTATGATAGTCAATATGGGTCCCCACCACCCATCAATGCATGGTGTTCTTC GACTCATCGTTACTCTAGATGGCGAAGATGTTATTGACTGTGAACCAATATTAGGTTATTTACACAGAGGCATGGAAAAA ATTGCGGAAAATCGAACAATTATACAATATTTGCCCTATGTAACACGTTGGGATTATTTGGCTACTATGTTCACAGAAGC AATAACAGTAAATGGCCCAGAACTGTTAGGAAATATTCAAGTGCCTAAAAGAGCTAGCTATATCAGGGTAATTATGTTGG AATTGAGTCGTATAGCTTCTCATTTATTATGGCTTGGCCCTTTTATGGCGGATATTGGGGCACAGACTCCTTTCTTCTAT ATTTTTAGAGAGAGAGAGTTAGTATATGATTTATTCGAAGCTGCCACTGGTATGAGAATGATGCATAATTATTTTCGTAT TGGGGGAGTAGCGGCTGATCTACCTCATGGCTGGATAGATAAATGTTTGGATTTTTGTGATTATTTTTTAACAAGAGTTG CTGAATATCAAAAACTTATTACGCGAAATCCTATTTTTTTAGAACGAGTTGAAGGAGTTGGTATTGTTGGTACAGAGGAA GCAATAAATTGGGGGTTATCAGGACCAATGCTACGAGCTTCCGGAGTACAATGGGATCTTCGTAAAATGGATCGTTATGA GTGTTACGACGAATTTGATTGGGAAGTCCAGTGGCAAAAAGAAGGGGATTCATTAGCTCGTTATTTAGTCCGAATTGGTG AAACGATGGAATCTATAAAAATTATTCAACAGGCTCTGGAAGGAATTCCGGGGGGGCCCTATGAAAATTTAGAAACCCGA CGTTTTGATAAAGAAGGGGATCCAGAATGGAACGATTTCGAATATCGATTCATTAGTAAAAGAACTTCTCCTACTTTTGA ATTACCGAAACAAGAACTTTATGTGAGAGTCGAAGCTCCAAAAGGAGAATTGGGAATTTTTCTGATAGGGGATCAGAGCG GTTTTCCTTGGAGATGGAAAATTCGCCCCCCGGGTTTTATCAATTTGCAAATTCTTCCTCAATTAGTTAAAAGAATGAAA TTGGCTGATATTATGACAATACTAGGTAGTATAGATATCATTATGGGAGAAGTTGATCGTTG
Product
Source
RefSeq
Link:
JCDBP00075
ID
JCDBP00075
Parent
JCDBR00109
Name
YP_002720168.1
Scaffold
NC_012224.1
CDS
131208-132389
Strand:
-
Sequence
MNVPAMRKDLMIVNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEA ITVNGPELLGNIQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGAQTPFFYIFRERELVYDLFEAATGMRMMHNYFRI GGVAADLPHGWIDKCLDFCDYFLTRVAEYQKLITRNPIFLERVEGVGIVGTEEAINWGLSGPMLRASGVQWDLRKMDRYE CYDEFDWEVQWQKEGDSLARYLVRIGETMESIKIIQQALEGIPGGPYENLETRRFDKEGDPEWNDFEYRFISKRTSPTFE LPKQELYVRVEAPKGELGIFLIGDQSGFPWRWKIRPPGFINLQILPQLVKRMKLADIMTILGSIDIIMGEVDR
Product
NADH dehydrogenase subunit 7
Source
RefSeq
Link
YP_002720168.1
InterProScan
IPR001135 NADH-quinone oxidoreductase, subunit D
IPR014029 NADH:ubiquinone oxidoreductase, 49kDa subunit, conserved site
IPR022885 NAD(P)H-quinone oxidoreductase subunit D/H
IPR029014 NiFe hydrogenase-like
Pfam
PF00346.15 Complex1_49kDa Family