Detail information of JCDBG00111

JCDBG00111
ID
JCDBG00111
Name
rps15
Type
protein_coding
Scaffold
NC_012224.1
Start
132496
End
132768
Strand
-
Link
Genbank id:7564804
Molecular function
GO:0003735 | structural constituent of ribosome
Cellular component
GO:0005840 | ribosome
GO:0005622 | intracellular
Biological process
GO:0006412 | translation
KEGG
Entry: K02956
Name: RP-S15, MRPS15, rpsO
Definition: small subunit ribosomal protein S15
ko03010:   Ribosome
Source
RefSeq
TF
Description
Sequence
TATGGTAAAAAATTCATTCATTTCGGTTATTTCACAAGAAGAAAAAAACGAAAACAAAGAATCCGTTGAATTTCAAATAG TAAGTTTCACTAATAAGATACGAAGACTTACTTCACATTTGGAATTGCATAGAAAAGACTATTCATCTCAGAGGGGTTTG CGGAAAATTCTAGGAAAACGTCAACGATCGCTGTCTTATTTAGCAAAGAAAAAGAGAGTACGTTATAAAGAATTAATTAG CCGGTTGGATATTCGGGAGTCAAAAATTCGTTA
Gene structure

JCDB Genes gff download

JCDBG00111 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR00110
ID
JCDBR00110
Name
rps15
Type
protein_coding
Scaffold
NC_012224.1
Start
132496
End
132768
Strand
-
Exon
132496-132768
Sequence
TATGGTAAAAAATTCATTCATTTCGGTTATTTCACAAGAAGAAAAAAACGAAAACAAAGAATCCGTTGAATTTCAAATAG TAAGTTTCACTAATAAGATACGAAGACTTACTTCACATTTGGAATTGCATAGAAAAGACTATTCATCTCAGAGGGGTTTG CGGAAAATTCTAGGAAAACGTCAACGATCGCTGTCTTATTTAGCAAAGAAAAAGAGAGTACGTTATAAAGAATTAATTAG CCGGTTGGATATTCGGGAGTCAAAAATTCGTTA
Product
Source
RefSeq
Link:
JCDBP00076
ID
JCDBP00076
Parent
JCDBR00110
Name
YP_002720169.1
Scaffold
NC_012224.1
CDS
132496-132768
Strand:
-
Sequence
MVKNSFISVISQEEKNENKESVEFQIVSFTNKIRRLTSHLELHRKDYSSQRGLRKILGKRQRSLSYLAKKKRVRYKELIS RLDIRESKIR
Product
rps15
Source
RefSeq
Link
YP_002720169.1
InterProScan
IPR000589 Ribosomal protein S15
IPR005290 Ribosomal protein S15, bacterial-type
IPR009068 S15/NS1, RNA-binding
Pfam
PF00312.18 Ribosomal_S15 Domain