Detail information of JCDBG00112

JCDBG00112
ID
JCDBG00112
Name
ycf1
Type
protein_coding
Scaffold
NC_012224.1
Start
133196
End
138919
Strand
-
Link
Genbank id:7564805
Molecular function
Cellular component
GO:0016021 | integral component of membrane
Biological process
KEGG
Source
RefSeq
TF
Description
Sequence
GATGATTTTGAAATCTTTTATACTAGGTAATCTAGTATCCTTATGCATGAAGATAATCAATTCGGTCGTTGTGGTCGGAC TCTATTATGGATTTCTGACCACATTCTCCACGGGGCCCTCTTATCTCTTCCTTCTTCGAGCTCGGGTTATAGAAGAAGGA GAAGAAGGAACTGAGAAGAAGGTATCAGCAACAACAGGTTTTATTACGGGACAGCTCATGATGTTCATATCGATCTATTA TGCGCCTCTGCATCTAGCATTGGGTAGACCTCATACAATAACTGTCCTAGCTCTACCCTATCTTTTGTTTCATTTCTTCT GGAACAATCACAAACACTTTTTTGATTATGGATCTACTACCAGAAATTCAATGCGTAATCTTAGCATTCAATTTGTATTC CTGAATAATCTCATTTTTCAATTATTCAACCATTTCATTTTACCAAGTTCAATGTTAGTCAGATTAGTCAACATTTATAT GTTTCGATGCAACAACAAGATGTTATTTGTAACAAGTAGTTTTGTTGGTTGGTTAATTGGTCACATTTTATTCATGAAAT GGGTTGGATTGATATTAGTCTGGATACAGCAAAATAATTCTATTAGATCGAATGTACTTTTTCGATCTAATAAGTACCTT GTGTCAGAATTGAGAAATTCTATGGCTCGAATCTTTAGTATTCTCTTATTTATTACCTGTGTCTACTCTTTAGGCAGAAT ACCGTCACCCATTTTTACTAAGAAACTGAAAGAAACCTCAGAAGCGGAAGAAAGGGAGGAAGAAACAGATGTAGAAATAG AAACAACTTCCGAAACGAAGGGGACTAAACAGGAACAAGAGGGATCCACCGAAGAAGATCCTTCTTCTTCCCTTTTTTCG GAAGAAAAGGAGGATCCGGACAAAATCGACGAAACGGAAGAGATCCAAGTGAATGGAAAGGAAAAAACAAAGGATGAATT CCATTTTCACTTTAAAGAGACATGCTATAAAAATAGACCACTTTATGAAACTTTTTATCTGGATGGGAATCAAGAAAATT CGAAGTTAGAAATATTGATAGATAAAAAAAATAAAGATCTTTTCTGGTTTGAAAAACCTCTTGTAACTATTCTTTTTGAC TCTAAACGTTGGAATCGTCCATTTCGATATATAAAAAATGATCAGTTTGAGAATGCTGTAAGAAAAGAAATGTCACAATA TTTTTTTTATACATGTCGAAGTGATGGAAAAGAAAGAATATCTTTTACGTATCCACCCAGTTTGTCAACTTTTTTGGAAA TGATACAAAGAAGGATGTCCCTGTTTACAACAGAAAAACTCTCCTCCGATGAATTGTATAATCGTTGGAATTATAAGAAT GAACAAAAAAAGAAAAATCTAAGTAATGAATTTATAAAAAGAGTCCAGGCTTTAGATAAGGGATATCTTGCTCTGAATAC ACTCCAAAAAAGGACTAGATTGTGTAATGATAAAACTAAAAAAGAGTACTTACCTAAAATATATGATCCCTTATTGAGTG GGTCATACCGCGGAAAAATCCAATTTTTTTTTTCACCCTCAATTTTAAATAAAACTTCCATAAAAAATTCTATAGAGATG GTTTGGATAAATAAAATTCATCTTTTTCTTCTTATTACTAATTATCAAAAATTCGAACCAAAAACAGATGTAAAATCATT TTCAACAGAAATTGCTTATTTCTTAAACTTAATTAATGAATTTGCCGGAAAATCAAGATCGAGTTTAAATTTTAAGGAAC TCTCTTTATTTCCAGATCACAAAGAAGAAAAAATGGATTTAGAAAATCGAATAAAAATTTTCAAATTTTTATTTGATACA GTTATCGCGAATTCAAAAAATAAAACAATTAGAAATAATTCTATTGGAATAAAAGAAATAAGTAAACAAGTTCCTCGATG GTCATATAAATTAATTGACGATTTGGAACAACAAGAGGGAGAAAATGAAGAAAATGAAGAAAACATGGCGGAAGATCATG AAATTCGTTCACGAAAAGCCAAACGTGTAGTGATTTTTACTGATAATCAACAAAATACTGAGACTTATAATAATACCAAA GATACAACGAATTCTGATCAAATAGACAAAGTGACTTTGATACGTTATTCACAACAATCGGACTTTCGTCGAGACATAAT AAAAGGATCTATGCGAGCACAAAGACGCAAAATACCTATATTGGAACTGTTTCAAGCAAATGTGCATTCCCCCCTTTTTT TGGACAGAATAGACAAATCCCTTGTTTTTTCTTTTGATATTTCCGAACTAATGAAAACAATGTTTATAAATTGGACGTGT AAAAACGCAGAATTCACAATTTCGGATTCTACTTATACAGAGAAAAAACAAAAAGAAAGTAAAAAAAAAGAAGACGACAA AAGAGAGGAAAAAGCTCGGATAGAAATAGCCGAAGCCTGGGATAGCATTCTTTTTGCTCAAGCAATAAGAGGGTGTGTTT TAGTAACCCAGTCGATTCTTAGAAAATATATTATATTAACTTTTTTAATAATAACTAAAAATATCATTCGTATACTACTT TTTCAAATTCCCGAATGGTCTGAGGATTTTAAAGATTGGAGTAGAGAAATGCATGTTAAATGCACTTATAATGGAGTTCA ATTATCCGAAAAAGAATTTCCAAAAAACTGGTTAACAGACGGGATTCAAATAAAGATCCTATTTCCTTTTCGTCTAAAAC CTTGGCACAGATCTAAGTTAAAACTCCCTCCCAAAGATCCAATGAAAAAGAAAACACAAAAACGGATTTTTGTTTTTTTA ACAGTTTGGGGAATGGAAGTTGAATTGCCTTTTGGTTCTCCCCGAAAACGGCTTTCCCTCTTTGAACCCATCTTTAAAAA ACTCGAAAAAAAAATTCGAAAAATAAAAAAAAAAGGTTTTCGAGTTCTAACAATTTTAGAAGAAAGAAGAAAATTTTTTC TAAAATTATCAAAAGAAAAAAAAATTGGGTTATCAAAAACATTTTTTTTCGAAAAGAAAAAAGAAATAATAAACAAATTT TCAAAATCAAAAAGAAATGCAAATTTATTATCTGGATTTATAAAAGTATATGAATTGAATGAAACTAAAAAAGAAAAAAA TTCAATAATCGATAACAATAATGGAACGATTCAAAAATTGTCTACTCCAACTCGATCTATGGCTTGGACAAATTATTCAC TAACAGAAAAAAAAATGAAAGATCTTTCTTCTAGAAGAAAGATAATCATAAATCAAATAGAAAAAATGAAAAAAGAAAAG GAAACAAAAATTATAACCTCAAAAATACATATTAATCCTAACAAAATAAGTTATAATGTTAAAAAATTAAAATCATCAAA AAATATTTCACAGATACAGATATTAAAAAGGGGAAATGCTCGATTAGTGCGTAAATTCCATTTTTTTATAAAAATTTTGA TTCAAAGGATATACATAGATATCTTTTTAAGTATCATTAATATTCCGAGGATCAATGCACAGCTTTTTCTTGAATCAACA AAAAAATTATTACTAAATATGTTTGCAATAATGAAAAAAAAATCACAAAAAATTGATAAAACAAAGCAAAATACAATTCA CTTTCTTTCGATTATGATTATAAAAAAGTTACTTAATAATAGTAATATTGCTGTTATTAATAACAATTCACAGATTTTTT GTGATATATCCTCCTTGTCACAAACATATGTATTTTACAAATTATCACAAATCCAAATTATTAATTTATATAAGTTACGA TCTATCCTTCAATATCATGGCCTTTTTCTTAAGAATGAGATAAAGGATTATTTTAGAGCCCAAGGGATATTTAATTCCAA ATTAAAAGATAAAAATTTTCAAAATTTCGTAATAAATCAATGGAAAAACTGGTTAAGGGGTCATTATCAATATAAATATG ATTTAACTCAGATTAGATGGTCTAGATTAATATCACAAAAATGGCGAAATAGAATCAAGCAACACCATATGGTTCAAAAT AAAAAATTTAATAAATTCAATTTATATGAAAAAGACCAATTAAATGAAAAAAGACCAATTAATTCATTACGAAAAAAAAA TGATAATGATTTTGCGGCAGATTCATTACCGAATCAAAAAAAGAATTTTCAAAAACACTGTAGATATAATCTTTTATCAT ATAAATCCATTAATTATGAAAATAAGAAGAACTCATATATTTACGGATTCCCATTACAAGTAAATAAACAAGAGATTTCT TATAATTACAACACAAATAAAAGCAAATTATTTGACATGTTGGAAAGTATTCCTATCAATAATTATCTAGGGGAAGATGA TATTAGCGATATGGAGAAAAGCCCGACTAGAAAATATTTGGATTGGAGAATTCTCGATTTTTGTCTTAGAAAAAAGGTCG ATATTGAGTCCTGGATTGATATCGGAAGCAAAGAAAAAAAAAATACTAAGACTAGGACTAATAAGTATCAAATAATTGAT AAAATCGATAAGAAAAATCTTCTTTTTCTTACAATTCACCAAGATCAAGAAGTCAATTCATCCAATCAAAAAAAAAACCT TTTTGATTGGCTGGGAATGAATGAAGAAATACAAAATCGTCTCATATCCAATTTTGAACTTTGGTTCTTTCGAAAATTTG TGATACTTTATAACACATATAAGATAAAACCATGGGCAATACCCATCCAATTTCTTCTTTTCAATTTTCATAGAAATGAA AATGTTAGTAAAAATACTAAAATCAACGAGAAGAAAAACGGCGATCTTTTTATATCATCGAATGAAAAAAAATTCATTGA ATTAGAGAATCGAAATCACGAAGAAAAAGAATCCAAAGACAAAATGGACTTTGGATCAGTTTTCGCAAATCAAGAAAAAA ATATTGAAGAAGATTATATGGGATTAGATATGAAAAAACATAGAAATAAAAAACAAAACAAAAGTCATACGGAAGTAGAG CTTGATTTCTTCCTAAAACGGTATTTATGTTTTCAATTAAGATGGAATGATTCTTTAAATGAAAAAATAATCAATAATAT CAAAGTATATTGTCTCCTGCTTAGACTGACAAATCCACGAGAAATTCTTATATCTTCTATTCAAAGACAAGAAATAAGTC TGAATATTCTGATGGTTCAGAAGGATTTAACTCTTACTGAATTGATGAAAAAGGGAATATTTATTATCGAACCTGTTCGT TTGTCAGTAAAAAATAATGGACAATTTCTTTTGTATCAAACGGTAGGTATCTTATTAGTTCATAAGAACAAACAACAAAT TAATCAAAAATACAGAGAAAAAATCTATATTGATAAAAAGAATTTTACCGAACCTATTGAAAGACATCAAAGTCTAATTG GCAATAGAGACAAAAATGATTATGATTTACTTGTTCCTGAAAATATTTTATTCCCTAAACGTCGTAGAGAATTAAGAATT CTAACTTCTTTCAATTTTAAAAACCAAAATGATATTCATAAAAATGATATTCATATAAATACAGAAATTTTCAACGTTAA TAAAATAAAAAACTGTGGTCCTATTTTGGATAAAAGTAAACATTTTGATAGAGATAAAAATAAACTAATTAAATTCAAAT TTTTTCTTTGGCCCCATTTTCGATTAGAAGATTTAGCTTGTATGAATCGCTATTGGTTTGATACTAATAATGCCAGTTGC TTCAGTATGGTAAGAATATATATATATCCACGGGCGCAATTTTA
Gene structure

JCDB Genes gff download

JCDBG00112 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG00112's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG00112JCDBG00012co-exp0.961499
JCDBG00112JCDBG00037co-exp0.958141
JCDBG00112JCDBG00065co-exp0.944148
JCDBG00112JCDBG00063co-exp0.929563
JCDBG00112JCDBG00075co-exp0.92744
JCDBG00112JCDBG00046co-exp0.924872
JCDBG00112JCDBG11239co-exp0.919971
JCDBG00112JCDBG00062co-exp0.902815
JCDBG00112JCDBG00069co-exp0.901977
JCDBG00112JCDBG04360co-exp0.900599
JCDBG00012JCDBG00037co-exp0.963833
JCDBG00012JCDBG00065co-exp0.946607
JCDBG00012JCDBG00063co-exp0.938615
JCDBG00012JCDBG00075co-exp0.912519
JCDBG00012JCDBG00046co-exp0.949104
JCDBG00012JCDBG11239co-exp0.912939
JCDBG00012JCDBG00062co-exp0.910668
JCDBG00012JCDBG00069co-exp0.905684
JCDBG00012JCDBG04360co-exp0.889528
JCDBG00037JCDBG00065co-exp0.962165
JCDBG00037JCDBG00063co-exp0.966339
JCDBG00037JCDBG00075co-exp0.939222
JCDBG00037JCDBG00046co-exp0.956923
JCDBG00037JCDBG11239co-exp0.943379
JCDBG00037JCDBG00062co-exp0.934869
JCDBG00037JCDBG00069co-exp0.914379
JCDBG00037JCDBG04360co-exp0.919883
JCDBG00065JCDBG00063co-exp0.942622
JCDBG00065JCDBG00075co-exp0.920844
JCDBG00065JCDBG00046co-exp0.954196
JCDBG00065JCDBG11239co-exp0.91345
JCDBG00065JCDBG00062co-exp0.946062
JCDBG00065JCDBG00069co-exp0.883197
JCDBG00065JCDBG04360co-exp0.916325
JCDBG00063JCDBG00075co-exp0.953019
JCDBG00063JCDBG00046co-exp0.932346
JCDBG00063JCDBG11239co-exp0.950032
JCDBG00063JCDBG00062co-exp0.914786
JCDBG00063JCDBG00069co-exp0.911133
JCDBG00063JCDBG04360co-exp0.91206
JCDBG00075JCDBG00046co-exp0.886163
JCDBG00075JCDBG11239co-exp0.952265
JCDBG00075JCDBG00062co-exp0.905767
JCDBG00075JCDBG00069co-exp0.910429
JCDBG00075JCDBG04360co-exp0.920042
JCDBG00046JCDBG11239co-exp0.899265
JCDBG00046JCDBG00062co-exp0.908979
JCDBG00046JCDBG00069co-exp0.864569
JCDBG00046JCDBG04360co-exp0.88938
JCDBG11239JCDBG00062co-exp0.888295
JCDBG11239JCDBG00069co-exp0.89206
JCDBG11239JCDBG04360co-exp0.944086
JCDBG00062JCDBG00069co-exp0.90278
JCDBG00062JCDBG04360co-exp0.887609
JCDBG00069JCDBG04360co-exp0.852987
PPI network
node1node2type
JCDBR00111
ID
JCDBR00111
Name
ycf1
Type
protein_coding
Scaffold
NC_012224.1
Start
133196
End
138919
Strand
-
Exon
133196-138919
Sequence
GATGATTTTGAAATCTTTTATACTAGGTAATCTAGTATCCTTATGCATGAAGATAATCAATTCGGTCGTTGTGGTCGGAC TCTATTATGGATTTCTGACCACATTCTCCACGGGGCCCTCTTATCTCTTCCTTCTTCGAGCTCGGGTTATAGAAGAAGGA GAAGAAGGAACTGAGAAGAAGGTATCAGCAACAACAGGTTTTATTACGGGACAGCTCATGATGTTCATATCGATCTATTA TGCGCCTCTGCATCTAGCATTGGGTAGACCTCATACAATAACTGTCCTAGCTCTACCCTATCTTTTGTTTCATTTCTTCT GGAACAATCACAAACACTTTTTTGATTATGGATCTACTACCAGAAATTCAATGCGTAATCTTAGCATTCAATTTGTATTC CTGAATAATCTCATTTTTCAATTATTCAACCATTTCATTTTACCAAGTTCAATGTTAGTCAGATTAGTCAACATTTATAT GTTTCGATGCAACAACAAGATGTTATTTGTAACAAGTAGTTTTGTTGGTTGGTTAATTGGTCACATTTTATTCATGAAAT GGGTTGGATTGATATTAGTCTGGATACAGCAAAATAATTCTATTAGATCGAATGTACTTTTTCGATCTAATAAGTACCTT GTGTCAGAATTGAGAAATTCTATGGCTCGAATCTTTAGTATTCTCTTATTTATTACCTGTGTCTACTCTTTAGGCAGAAT ACCGTCACCCATTTTTACTAAGAAACTGAAAGAAACCTCAGAAGCGGAAGAAAGGGAGGAAGAAACAGATGTAGAAATAG AAACAACTTCCGAAACGAAGGGGACTAAACAGGAACAAGAGGGATCCACCGAAGAAGATCCTTCTTCTTCCCTTTTTTCG GAAGAAAAGGAGGATCCGGACAAAATCGACGAAACGGAAGAGATCCAAGTGAATGGAAAGGAAAAAACAAAGGATGAATT CCATTTTCACTTTAAAGAGACATGCTATAAAAATAGACCACTTTATGAAACTTTTTATCTGGATGGGAATCAAGAAAATT CGAAGTTAGAAATATTGATAGATAAAAAAAATAAAGATCTTTTCTGGTTTGAAAAACCTCTTGTAACTATTCTTTTTGAC TCTAAACGTTGGAATCGTCCATTTCGATATATAAAAAATGATCAGTTTGAGAATGCTGTAAGAAAAGAAATGTCACAATA TTTTTTTTATACATGTCGAAGTGATGGAAAAGAAAGAATATCTTTTACGTATCCACCCAGTTTGTCAACTTTTTTGGAAA TGATACAAAGAAGGATGTCCCTGTTTACAACAGAAAAACTCTCCTCCGATGAATTGTATAATCGTTGGAATTATAAGAAT GAACAAAAAAAGAAAAATCTAAGTAATGAATTTATAAAAAGAGTCCAGGCTTTAGATAAGGGATATCTTGCTCTGAATAC ACTCCAAAAAAGGACTAGATTGTGTAATGATAAAACTAAAAAAGAGTACTTACCTAAAATATATGATCCCTTATTGAGTG GGTCATACCGCGGAAAAATCCAATTTTTTTTTTCACCCTCAATTTTAAATAAAACTTCCATAAAAAATTCTATAGAGATG GTTTGGATAAATAAAATTCATCTTTTTCTTCTTATTACTAATTATCAAAAATTCGAACCAAAAACAGATGTAAAATCATT TTCAACAGAAATTGCTTATTTCTTAAACTTAATTAATGAATTTGCCGGAAAATCAAGATCGAGTTTAAATTTTAAGGAAC TCTCTTTATTTCCAGATCACAAAGAAGAAAAAATGGATTTAGAAAATCGAATAAAAATTTTCAAATTTTTATTTGATACA GTTATCGCGAATTCAAAAAATAAAACAATTAGAAATAATTCTATTGGAATAAAAGAAATAAGTAAACAAGTTCCTCGATG GTCATATAAATTAATTGACGATTTGGAACAACAAGAGGGAGAAAATGAAGAAAATGAAGAAAACATGGCGGAAGATCATG AAATTCGTTCACGAAAAGCCAAACGTGTAGTGATTTTTACTGATAATCAACAAAATACTGAGACTTATAATAATACCAAA GATACAACGAATTCTGATCAAATAGACAAAGTGACTTTGATACGTTATTCACAACAATCGGACTTTCGTCGAGACATAAT AAAAGGATCTATGCGAGCACAAAGACGCAAAATACCTATATTGGAACTGTTTCAAGCAAATGTGCATTCCCCCCTTTTTT TGGACAGAATAGACAAATCCCTTGTTTTTTCTTTTGATATTTCCGAACTAATGAAAACAATGTTTATAAATTGGACGTGT AAAAACGCAGAATTCACAATTTCGGATTCTACTTATACAGAGAAAAAACAAAAAGAAAGTAAAAAAAAAGAAGACGACAA AAGAGAGGAAAAAGCTCGGATAGAAATAGCCGAAGCCTGGGATAGCATTCTTTTTGCTCAAGCAATAAGAGGGTGTGTTT TAGTAACCCAGTCGATTCTTAGAAAATATATTATATTAACTTTTTTAATAATAACTAAAAATATCATTCGTATACTACTT TTTCAAATTCCCGAATGGTCTGAGGATTTTAAAGATTGGAGTAGAGAAATGCATGTTAAATGCACTTATAATGGAGTTCA ATTATCCGAAAAAGAATTTCCAAAAAACTGGTTAACAGACGGGATTCAAATAAAGATCCTATTTCCTTTTCGTCTAAAAC CTTGGCACAGATCTAAGTTAAAACTCCCTCCCAAAGATCCAATGAAAAAGAAAACACAAAAACGGATTTTTGTTTTTTTA ACAGTTTGGGGAATGGAAGTTGAATTGCCTTTTGGTTCTCCCCGAAAACGGCTTTCCCTCTTTGAACCCATCTTTAAAAA ACTCGAAAAAAAAATTCGAAAAATAAAAAAAAAAGGTTTTCGAGTTCTAACAATTTTAGAAGAAAGAAGAAAATTTTTTC TAAAATTATCAAAAGAAAAAAAAATTGGGTTATCAAAAACATTTTTTTTCGAAAAGAAAAAAGAAATAATAAACAAATTT TCAAAATCAAAAAGAAATGCAAATTTATTATCTGGATTTATAAAAGTATATGAATTGAATGAAACTAAAAAAGAAAAAAA TTCAATAATCGATAACAATAATGGAACGATTCAAAAATTGTCTACTCCAACTCGATCTATGGCTTGGACAAATTATTCAC TAACAGAAAAAAAAATGAAAGATCTTTCTTCTAGAAGAAAGATAATCATAAATCAAATAGAAAAAATGAAAAAAGAAAAG GAAACAAAAATTATAACCTCAAAAATACATATTAATCCTAACAAAATAAGTTATAATGTTAAAAAATTAAAATCATCAAA AAATATTTCACAGATACAGATATTAAAAAGGGGAAATGCTCGATTAGTGCGTAAATTCCATTTTTTTATAAAAATTTTGA TTCAAAGGATATACATAGATATCTTTTTAAGTATCATTAATATTCCGAGGATCAATGCACAGCTTTTTCTTGAATCAACA AAAAAATTATTACTAAATATGTTTGCAATAATGAAAAAAAAATCACAAAAAATTGATAAAACAAAGCAAAATACAATTCA CTTTCTTTCGATTATGATTATAAAAAAGTTACTTAATAATAGTAATATTGCTGTTATTAATAACAATTCACAGATTTTTT GTGATATATCCTCCTTGTCACAAACATATGTATTTTACAAATTATCACAAATCCAAATTATTAATTTATATAAGTTACGA TCTATCCTTCAATATCATGGCCTTTTTCTTAAGAATGAGATAAAGGATTATTTTAGAGCCCAAGGGATATTTAATTCCAA ATTAAAAGATAAAAATTTTCAAAATTTCGTAATAAATCAATGGAAAAACTGGTTAAGGGGTCATTATCAATATAAATATG ATTTAACTCAGATTAGATGGTCTAGATTAATATCACAAAAATGGCGAAATAGAATCAAGCAACACCATATGGTTCAAAAT AAAAAATTTAATAAATTCAATTTATATGAAAAAGACCAATTAAATGAAAAAAGACCAATTAATTCATTACGAAAAAAAAA TGATAATGATTTTGCGGCAGATTCATTACCGAATCAAAAAAAGAATTTTCAAAAACACTGTAGATATAATCTTTTATCAT ATAAATCCATTAATTATGAAAATAAGAAGAACTCATATATTTACGGATTCCCATTACAAGTAAATAAACAAGAGATTTCT TATAATTACAACACAAATAAAAGCAAATTATTTGACATGTTGGAAAGTATTCCTATCAATAATTATCTAGGGGAAGATGA TATTAGCGATATGGAGAAAAGCCCGACTAGAAAATATTTGGATTGGAGAATTCTCGATTTTTGTCTTAGAAAAAAGGTCG ATATTGAGTCCTGGATTGATATCGGAAGCAAAGAAAAAAAAAATACTAAGACTAGGACTAATAAGTATCAAATAATTGAT AAAATCGATAAGAAAAATCTTCTTTTTCTTACAATTCACCAAGATCAAGAAGTCAATTCATCCAATCAAAAAAAAAACCT TTTTGATTGGCTGGGAATGAATGAAGAAATACAAAATCGTCTCATATCCAATTTTGAACTTTGGTTCTTTCGAAAATTTG TGATACTTTATAACACATATAAGATAAAACCATGGGCAATACCCATCCAATTTCTTCTTTTCAATTTTCATAGAAATGAA AATGTTAGTAAAAATACTAAAATCAACGAGAAGAAAAACGGCGATCTTTTTATATCATCGAATGAAAAAAAATTCATTGA ATTAGAGAATCGAAATCACGAAGAAAAAGAATCCAAAGACAAAATGGACTTTGGATCAGTTTTCGCAAATCAAGAAAAAA ATATTGAAGAAGATTATATGGGATTAGATATGAAAAAACATAGAAATAAAAAACAAAACAAAAGTCATACGGAAGTAGAG CTTGATTTCTTCCTAAAACGGTATTTATGTTTTCAATTAAGATGGAATGATTCTTTAAATGAAAAAATAATCAATAATAT CAAAGTATATTGTCTCCTGCTTAGACTGACAAATCCACGAGAAATTCTTATATCTTCTATTCAAAGACAAGAAATAAGTC TGAATATTCTGATGGTTCAGAAGGATTTAACTCTTACTGAATTGATGAAAAAGGGAATATTTATTATCGAACCTGTTCGT TTGTCAGTAAAAAATAATGGACAATTTCTTTTGTATCAAACGGTAGGTATCTTATTAGTTCATAAGAACAAACAACAAAT TAATCAAAAATACAGAGAAAAAATCTATATTGATAAAAAGAATTTTACCGAACCTATTGAAAGACATCAAAGTCTAATTG GCAATAGAGACAAAAATGATTATGATTTACTTGTTCCTGAAAATATTTTATTCCCTAAACGTCGTAGAGAATTAAGAATT CTAACTTCTTTCAATTTTAAAAACCAAAATGATATTCATAAAAATGATATTCATATAAATACAGAAATTTTCAACGTTAA TAAAATAAAAAACTGTGGTCCTATTTTGGATAAAAGTAAACATTTTGATAGAGATAAAAATAAACTAATTAAATTCAAAT TTTTTCTTTGGCCCCATTTTCGATTAGAAGATTTAGCTTGTATGAATCGCTATTGGTTTGATACTAATAATGCCAGTTGC TTCAGTATGGTAAGAATATATATATATCCACGGGCGCAATTTTA
Product
Source
RefSeq
Link:
JCDBP00077
ID
JCDBP00077
Parent
JCDBR00111
Name
YP_002720170.1
Scaffold
NC_012224.1
CDS
133196-138919
Strand:
-
Sequence
MILKSFILGNLVSLCMKIINSVVVVGLYYGFLTTFSTGPSYLFLLRARVIEEGEEGTEKKVSATTGFITGQLMMFISIYY APLHLALGRPHTITVLALPYLLFHFFWNNHKHFFDYGSTTRNSMRNLSIQFVFLNNLIFQLFNHFILPSSMLVRLVNIYM FRCNNKMLFVTSSFVGWLIGHILFMKWVGLILVWIQQNNSIRSNVLFRSNKYLVSELRNSMARIFSILLFITCVYSLGRI PSPIFTKKLKETSEAEEREEETDVEIETTSETKGTKQEQEGSTEEDPSSSLFSEEKEDPDKIDETEEIQVNGKEKTKDEF HFHFKETCYKNRPLYETFYLDGNQENSKLEILIDKKNKDLFWFEKPLVTILFDSKRWNRPFRYIKNDQFENAVRKEMSQY FFYTCRSDGKERISFTYPPSLSTFLEMIQRRMSLFTTEKLSSDELYNRWNYKNEQKKKNLSNEFIKRVQALDKGYLALNT LQKRTRLCNDKTKKEYLPKIYDPLLSGSYRGKIQFFFSPSILNKTSIKNSIEMVWINKIHLFLLITNYQKFEPKTDVKSF STEIAYFLNLINEFAGKSRSSLNFKELSLFPDHKEEKMDLENRIKIFKFLFDTVIANSKNKTIRNNSIGIKEISKQVPRW SYKLIDDLEQQEGENEENEENMAEDHEIRSRKAKRVVIFTDNQQNTETYNNTKDTTNSDQIDKVTLIRYSQQSDFRRDII KGSMRAQRRKIPILELFQANVHSPLFLDRIDKSLVFSFDISELMKTMFINWTCKNAEFTISDSTYTEKKQKESKKKEDDK REEKARIEIAEAWDSILFAQAIRGCVLVTQSILRKYIILTFLIITKNIIRILLFQIPEWSEDFKDWSREMHVKCTYNGVQ LSEKEFPKNWLTDGIQIKILFPFRLKPWHRSKLKLPPKDPMKKKTQKRIFVFLTVWGMEVELPFGSPRKRLSLFEPIFKK LEKKIRKIKKKGFRVLTILEERRKFFLKLSKEKKIGLSKTFFFEKKKEIINKFSKSKRNANLLSGFIKVYELNETKKEKN SIIDNNNGTIQKLSTPTRSMAWTNYSLTEKKMKDLSSRRKIIINQIEKMKKEKETKIITSKIHINPNKISYNVKKLKSSK NISQIQILKRGNARLVRKFHFFIKILIQRIYIDIFLSIINIPRINAQLFLESTKKLLLNMFAIMKKKSQKIDKTKQNTIH FLSIMIIKKLLNNSNIAVINNNSQIFCDISSLSQTYVFYKLSQIQIINLYKLRSILQYHGLFLKNEIKDYFRAQGIFNSK LKDKNFQNFVINQWKNWLRGHYQYKYDLTQIRWSRLISQKWRNRIKQHHMVQNKKFNKFNLYEKDQLNEKRPINSLRKKN DNDFAADSLPNQKKNFQKHCRYNLLSYKSINYENKKNSYIYGFPLQVNKQEISYNYNTNKSKLFDMLESIPINNYLGEDD ISDMEKSPTRKYLDWRILDFCLRKKVDIESWIDIGSKEKKNTKTRTNKYQIIDKIDKKNLLFLTIHQDQEVNSSNQKKNL FDWLGMNEEIQNRLISNFELWFFRKFVILYNTYKIKPWAIPIQFLLFNFHRNENVSKNTKINEKKNGDLFISSNEKKFIE LENRNHEEKESKDKMDFGSVFANQEKNIEEDYMGLDMKKHRNKKQNKSHTEVELDFFLKRYLCFQLRWNDSLNEKIINNI KVYCLLLRLTNPREILISSIQRQEISLNILMVQKDLTLTELMKKGIFIIEPVRLSVKNNGQFLLYQTVGILLVHKNKQQI NQKYREKIYIDKKNFTEPIERHQSLIGNRDKNDYDLLVPENILFPKRRRELRILTSFNFKNQNDIHKNDIHINTEIFNVN KIKNCGPILDKSKHFDRDKNKLIKFKFFLWPHFRLEDLACMNRYWFDTNNASCFSMVRIYIYPRAQF
Product
Ycf1
Source
RefSeq
Link
YP_002720170.1
InterProScan
IPR008896 Protein TIC214
Pfam
PF05758.8 Ycf1 Family