Detail information of JCDBG25281

JCDBG25281
ID
JCDBG25281
Name
LOC105650690
Type
protein_coding
Scaffold
NW_012130064.1
Start
821550
End
824654
Strand
-
Link
Genbank id:105650690 | Jatropha Genome Database ID:Jcr4S05837.20
Molecular function
Cellular component
Biological process
KEGG
K09286
Source
Gnomon
TF
Description
hypothetical
Sequence
CTCAAGTTTCAGTCAGTACACTTACAGGTGACCAACCTTGAGAAGGAGGACAAGAGAGGatctctcactctctctctctc tctctctctctctccatatatatatatatatatatatattcaaccaCCAAGAAGAGATCAAGTAAGACTCTTGGATTTTG TGGGAAAAGATAACAGaactcaaaaacaaaaagctcGAGAGAGAGATGAGGCCAAATTGGGAGCTGAAGAATTGCTGCAA CCATGAACAAGTAGTGTTTCTCGTCACTGTCTCTGTCTGCACTGTTGTCATTCTTGCGGTATTTTTCTCACTCCCTATCA CTTTTGTGATTTCATAGAAGCTGCATTactgttgttattattatttttgatgagGCAGTGAAACCCATTAATGCtgttag ttttctttttcttccttttcatGGTTATGGTCAAGAAAAGTTggaatttttgtttgatctggGTATGATTGTCTTTCCAG AATAAACTGGTCTATTTATCCGAAACCTTTGCTATAATTTTCTCCTACTTTGGGTCCAATTATGTAAGATGTGTTTGATT TCTATGTGTTCACTAAAATCCAAATGGGTTTTCATGAATGCATTTTAGTATTTGTGAATCCCATTACAGATTTGGAATTA TATCACTGAAGATTGTATGGAAGTCTAAGTCTTGGAACCGGAGTATCAATCCTCAAATTTAAGTAATTCTTTTAGTGGCT TGATTcattaattgatatttatgaTTTCTTCCAATTAAAAGTGAAATGCCATAAATTCTGTTACATCTGTTGACTGATTA tgctacatttttttttttttttttgaaaatataactcattaatgataatatgaaaaattgcAAATACTTAATAGACCAGA CATAGAACTTCATGCTACAGTTAATATGAAGAGTTACAAATGCTTTTTAGTATTGGTTGACCGATTATGCTACAGTTAAT ACTCGAAAAAAGttatctttttatctttatagtTATGGAGAACAGTACTGCTGACACCATTCAAGCTTGTGACCGTGTTC CTTCATGAAGCAAGCCATGCCATTGCCTGTAAATTAACTTGTGGACATGTAAGCAGCTGCTCtctctcatttctttttct cttctttcttttgaattaaacaattaagaaatagtttccattgtcttttttttcttttcaattaaacACATGAatttaat tctcaaaaaaaaaaaaaagcatcaaTTTATTCTGAAACCTGCAAATTCTTCATTCCACAGCACTCTCTTGCAGCAAAGAC AATCAAACATACATTTGGCCAAAGTTGAATATCAAAATGTGAAGTGATTATGTGATTATCCAACTTTGAAAtgcttataa tttaaattaataactgTTTGGATGAGTCTATATTGCAGGTGGAAGGGATTCAGGTTCATGCAGATGAAGGAGGAACTACT CAAACACGTGGTGGTGTATACTGGTTTATCTTGCCAGCTGGATGTAACTTCTTTTTCCGTTGACTACCTTTCTTTATTCT TCTGAGAAATTCTTGGCTTAACTACATATATAGCTTCTCTCTGGATGAGCAATTTCACATATGGGGTTCAGAATCTGTAG TTCTAATTTAGTTGTTTCCACATGAATAAATGATCGTTCTTcgtaataattcaattttattttcacgTCTTTCCACTCTA GATCTTGGTTCATCCTTTTGGGGGATGGTTTTGATACTTGCATCCACAAATCTTCTTACAGCAAGAATTGCAGCAGGATG TTTTGTTGTTGCTCTGCTTGTTGTGTTGTTGGTAGCAAAAAATGTAAGTAGTTTCAAGCATCTAGAGTATGTCCTAATTA TAGAGTTGTAGTAAGTAAACATAACATTTGTGGATACGTGTATTTCAAATTCTTAAGGTGAAAATTCATAGcagatttta tatttatggcAATTGAACGAAGTTATTTAGACACCAAATTCTGGAAATAAATCACATGAAATGgcagaaaataaataaat gaatatagtAAAATgattcttaataatttatttcatggacgcctttcaattttaatgcaTTTCTAAGATCAAGTCAGTCA CATAatattatatctattaaataactgaaataattatttttctattattcaCACACAGTGGACTCTTCGAGGACTTTGTA TTGGTACGTATTTCTGTAACCTCGATAAATCTAGCTGCCTATGCTATGTACAAGCTTCAATATTCAGTGTACAActtcaa tgatatttttacaTGTTGAGCCATCAGGGTTTGTTCTTTTCCTTGGGGTGATTTGGGTCCTgcaagaaacaacaaaaatc CGTATCCTTCGGTATATTATTCTATTCATTGGTAAATGTAGCTCTGCATCTTTGCTTTCATTATGCCTCCTGTAATTCAC ActcttttctttaaaactaTTGAATGCTGTGATGTGTGCACTGCAGGTGTAATGAACAGCTTGTTTTCTGTTTATGGTAT GTAGAACAacctttcaaattttatcattaagttgtttgtttttattgaattatagaGCTCAACTACATCTCTTTGATTGT GCAGATATTTATGATGATCTGATATCTCGTAGAGTTCATTCTAGTGATGCTGAGAAATTTGCAGAAGTCTGCCCTTGTCC ATGTAATGGCATGGGGTGGGGCATGATTTGGTGAGCATCTTATATTCACCAAGTCAAATTGAAATGCTTGGTTTCTAGTT TCTATCCAAagtttttcttcccttttgaataaactaataaaaacttagatttcatttttagttgttCAActttattaatg aagaaaactATACTTGCAGGGGGTTTATATCTTTATTGCTTCTCTGTGGAGCAATGTACCTTGGTCTTGTGATATTGTCT TGAGGTACATTGCTAAGTAGCATGACAGAGAATTCAGGTTCAAATTGTTTCATCACTTGGAGGCCTAGACATCAACTTAT TAGATAGCAACTCCATGTTCTTATCAATGCCATCTCATTTTGTACAGGAGATGCTTTGATAAAGTGTccactttaaaatt ttgaacctttAGCGGCTGAAATTGGTTCAGTTTTAAGCTTTGGCTATAATTCATTGCTTTTACAT
Gene structure

JCDB Genes gff download

JCDBG25281 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG25281's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG25281JCDBG03575co-exp0.824884
JCDBG25281JCDBG06898co-exp0.788439
JCDBG25281JCDBG22706co-exp0.786201
JCDBG25281JCDBG21981co-exp0.781366
JCDBG25281JCDBG08169co-exp0.779928
JCDBG25281JCDBG24238co-exp0.778753
JCDBG25281JCDBG00683co-exp0.762533
JCDBG25281JCDBG06779co-exp0.75702
JCDBG25281JCDBG06963co-exp0.754536
JCDBG25281JCDBG24511co-exp0.753811
JCDBG03575JCDBG06898co-exp0.785648
JCDBG03575JCDBG22706co-exp0.807549
JCDBG03575JCDBG21981co-exp0.814809
JCDBG03575JCDBG08169co-exp0.886889
JCDBG03575JCDBG24238co-exp0.807996
JCDBG03575JCDBG00683co-exp0.818296
JCDBG03575JCDBG06779co-exp0.620994
JCDBG03575JCDBG06963co-exp0.851308
JCDBG03575JCDBG24511co-exp0.775415
JCDBG06898JCDBG22706co-exp0.75515
JCDBG06898JCDBG21981co-exp0.718387
JCDBG06898JCDBG08169co-exp0.896747
JCDBG06898JCDBG24238co-exp0.88719
JCDBG06898JCDBG00683co-exp0.783577
JCDBG06898JCDBG06779co-exp0.716059
JCDBG06898JCDBG06963co-exp0.845196
JCDBG06898JCDBG24511co-exp0.868935
JCDBG22706JCDBG21981co-exp0.880088
JCDBG22706JCDBG08169co-exp0.75813
JCDBG22706JCDBG24238co-exp0.80521
JCDBG22706JCDBG00683co-exp0.804631
JCDBG22706JCDBG06779co-exp0.673446
JCDBG22706JCDBG06963co-exp0.792632
JCDBG22706JCDBG24511co-exp0.793173
JCDBG21981JCDBG08169co-exp0.767761
JCDBG21981JCDBG24238co-exp0.808886
JCDBG21981JCDBG00683co-exp0.834256
JCDBG21981JCDBG06779co-exp0.652808
JCDBG21981JCDBG06963co-exp0.824579
JCDBG21981JCDBG24511co-exp0.760201
JCDBG08169JCDBG24238co-exp0.896802
JCDBG08169JCDBG00683co-exp0.804519
JCDBG08169JCDBG06779co-exp0.634914
JCDBG08169JCDBG06963co-exp0.90818
JCDBG08169JCDBG24511co-exp0.834477
JCDBG24238JCDBG00683co-exp0.806937
JCDBG24238JCDBG06779co-exp0.664464
JCDBG24238JCDBG06963co-exp0.938632
JCDBG24238JCDBG24511co-exp0.896553
JCDBG00683JCDBG06779co-exp0.621746
JCDBG00683JCDBG06963co-exp0.776884
JCDBG00683JCDBG24511co-exp0.792121
JCDBG06779JCDBG24511co-exp0.640919
JCDBG06963JCDBG24511co-exp0.852755
PPI network
node1node2type
JCDBR33769
ID
JCDBR33769
Name
XM_012237635.1
Type
Scaffold
NW_012130064.1
Start
821550
End
824654
Strand
-
Exon
821550-821836,821986-822091,822180-822209,822305-822388,822493-822517,822853-822974,823173-823257,823568-823663,824358-824654
Sequence
CTCAAGTTTCAGTCAGTACACTTACAGGTGACCAACCTTGAGAAGGAGGACAAGAGAGGatctctcactctctctctctc tctctctctctctccatatatatatatatatatatatattcaaccaCCAAGAAGAGATCAAGTAAGACTCTTGGATTTTG TGGGAAAAGATAACAGaactcaaaaacaaaaagctcGAGAGAGAGATGAGGCCAAATTGGGAGCTGAAGAATTGCTGCAA CCATGAACAAGTAGTGTTTCTCGTCACTGTCTCTGTCTGCACTGTTGTCATTCTTGCGGTATTTTTCTCACTCCCTATCA CTTTTGTGATTTCATAGAAGCTGCATTactgttgttattattatttttgatgagGCAGTGAAACCCATTAATGCtgttag ttttctttttcttccttttcatGGTTATGGTCAAGAAAAGTTggaatttttgtttgatctggGTATGATTGTCTTTCCAG AATAAACTGGTCTATTTATCCGAAACCTTTGCTATAATTTTCTCCTACTTTGGGTCCAATTATGTAAGATGTGTTTGATT TCTATGTGTTCACTAAAATCCAAATGGGTTTTCATGAATGCATTTTAGTATTTGTGAATCCCATTACAGATTTGGAATTA TATCACTGAAGATTGTATGGAAGTCTAAGTCTTGGAACCGGAGTATCAATCCTCAAATTTAAGTAATTCTTTTAGTGGCT TGATTcattaattgatatttatgaTTTCTTCCAATTAAAAGTGAAATGCCATAAATTCTGTTACATCTGTTGACTGATTA tgctacatttttttttttttttttgaaaatataactcattaatgataatatgaaaaattgcAAATACTTAATAGACCAGA CATAGAACTTCATGCTACAGTTAATATGAAGAGTTACAAATGCTTTTTAGTATTGGTTGACCGATTATGCTACAGTTAAT ACTCGAAAAAAGttatctttttatctttatagtTATGGAGAACAGTACTGCTGACACCATTCAAGCTTGTGACCGTGTTC CTTCATGAAGCAAGCCATGCCATTGCCTGTAAATTAACTTGTGGACATGTAAGCAGCTGCTCtctctcatttctttttct cttctttcttttgaattaaacaattaagaaatagtttccattgtcttttttttcttttcaattaaacACATGAatttaat tctcaaaaaaaaaaaaaagcatcaaTTTATTCTGAAACCTGCAAATTCTTCATTCCACAGCACTCTCTTGCAGCAAAGAC AATCAAACATACATTTGGCCAAAGTTGAATATCAAAATGTGAAGTGATTATGTGATTATCCAACTTTGAAAtgcttataa tttaaattaataactgTTTGGATGAGTCTATATTGCAGGTGGAAGGGATTCAGGTTCATGCAGATGAAGGAGGAACTACT CAAACACGTGGTGGTGTATACTGGTTTATCTTGCCAGCTGGATGTAACTTCTTTTTCCGTTGACTACCTTTCTTTATTCT TCTGAGAAATTCTTGGCTTAACTACATATATAGCTTCTCTCTGGATGAGCAATTTCACATATGGGGTTCAGAATCTGTAG TTCTAATTTAGTTGTTTCCACATGAATAAATGATCGTTCTTcgtaataattcaattttattttcacgTCTTTCCACTCTA GATCTTGGTTCATCCTTTTGGGGGATGGTTTTGATACTTGCATCCACAAATCTTCTTACAGCAAGAATTGCAGCAGGATG TTTTGTTGTTGCTCTGCTTGTTGTGTTGTTGGTAGCAAAAAATGTAAGTAGTTTCAAGCATCTAGAGTATGTCCTAATTA TAGAGTTGTAGTAAGTAAACATAACATTTGTGGATACGTGTATTTCAAATTCTTAAGGTGAAAATTCATAGcagatttta tatttatggcAATTGAACGAAGTTATTTAGACACCAAATTCTGGAAATAAATCACATGAAATGgcagaaaataaataaat gaatatagtAAAATgattcttaataatttatttcatggacgcctttcaattttaatgcaTTTCTAAGATCAAGTCAGTCA CATAatattatatctattaaataactgaaataattatttttctattattcaCACACAGTGGACTCTTCGAGGACTTTGTA TTGGTACGTATTTCTGTAACCTCGATAAATCTAGCTGCCTATGCTATGTACAAGCTTCAATATTCAGTGTACAActtcaa tgatatttttacaTGTTGAGCCATCAGGGTTTGTTCTTTTCCTTGGGGTGATTTGGGTCCTgcaagaaacaacaaaaatc CGTATCCTTCGGTATATTATTCTATTCATTGGTAAATGTAGCTCTGCATCTTTGCTTTCATTATGCCTCCTGTAATTCAC ActcttttctttaaaactaTTGAATGCTGTGATGTGTGCACTGCAGGTGTAATGAACAGCTTGTTTTCTGTTTATGGTAT GTAGAACAacctttcaaattttatcattaagttgtttgtttttattgaattatagaGCTCAACTACATCTCTTTGATTGT GCAGATATTTATGATGATCTGATATCTCGTAGAGTTCATTCTAGTGATGCTGAGAAATTTGCAGAAGTCTGCCCTTGTCC ATGTAATGGCATGGGGTGGGGCATGATTTGGTGAGCATCTTATATTCACCAAGTCAAATTGAAATGCTTGGTTTCTAGTT TCTATCCAAagtttttcttcccttttgaataaactaataaaaacttagatttcatttttagttgttCAActttattaatg aagaaaactATACTTGCAGGGGGTTTATATCTTTATTGCTTCTCTGTGGAGCAATGTACCTTGGTCTTGTGATATTGTCT TGAGGTACATTGCTAAGTAGCATGACAGAGAATTCAGGTTCAAATTGTTTCATCACTTGGAGGCCTAGACATCAACTTAT TAGATAGCAACTCCATGTTCTTATCAATGCCATCTCATTTTGTACAGGAGATGCTTTGATAAAGTGTccactttaaaatt ttgaacctttAGCGGCTGAAATTGGTTCAGTTTTAAGCTTTGGCTATAATTCATTGCTTTTACAT
Product
uncharacterized LOC105650690
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237635.1
JCDBP29700
ID
JCDBP29700
Parent
JCDBR33769
Name
XP_012093025.1
Scaffold
NW_012130064.1
CDS
821773-821836,821986-822091,822180-822209,822305-822388,822493-822517,822853-822974,823173-823257,823568-823663,824358-824450
Strand:
-
Sequence
MRPNWELKNCCNHEQVVFLVTVSVCTVVILALWRTVLLTPFKLVTVFLHEASHAIACKLTCGHVEGIQVHADEGGTTQTR GGVYWFILPAGYLGSSFWGMVLILASTNLLTARIAAGCFVVALLVVLLVAKNWTLRGLCIGFVLFLGVIWVLQETTKIRI LRYIILFIGVMNSLFSVYDIYDDLISRRVHSSDAEKFAEVCPCPCNGMGWGMIWGFISLLLLCGAMYLGLVILS
Product
uncharacterized protein LOC105650690
Source
Gnomon
Link
XP_012093025.1
InterProScan
Pfam
PF13398.2 Peptidase_M50B Family