Detail information of JCDBG25282

JCDBG25282
ID
JCDBG25282
Name
LOC105650691
Type
protein_coding
Scaffold
NW_012130064.1
Start
825649
End
826704
Strand
+
Link
Genbank id:105650691 | Jatropha Genome Database ID:Jcr4S05837.30
Molecular function
GO:0003677 | DNA binding
GO:0003700 | transcription factor activity, sequence-specific DNA binding
Cellular component
Biological process
GO:0006355 | regulation of transcription, DNA-templated
KEGG
Entry: K09286
Name: EREBP
Definition: EREBP-like factor
Source
Gnomon
TF
ERF
Description
ethylene-responsive
Sequence
CAACTTCATCTATAAAACGCGCTGCCCCTATTCCCGTCTCAACCCACCGCGTTGGGTAACCAAAACCGGCactcattatt ttcttctccGCTTCACCTAAACGACAACCAAAGATTCGAAATGGCTCCCAAAGAGAAGAGCATCGCCGCCTCCACTGGCC TCAAGAAAGGTACCATTACCAACAATAACGATAAGAAGGAAATGCATTACAGAGGAGTTAGAAAGAGGCCTTGGGGTCGT TACGCCGCCGAGATACGGGATCCGGGGAAGAAGAGCCGGGTCTGGTTAGGCACTTTTGATACGGCTGAGGAAGCTGCTAC AGCTTATGACAAGGCGGCGCGTGAATTCCGTGGCCCTAAGGCCAAGACTAACTTTCCTCTTCCCACCGAAATCACTCCGA TTAAAACCAAGGTCGCTAACTGCACTGATGACCCAAGTCCTAGCCAGAGCAGCACGGTTGAATCCTCCAGTCCGCCGGCT GCGCGTGAGATCACACACGACCTTGTGGAAAGGTTTCCGTTTGTTTATCAGCAGCAGAACGTGGTGGGTCCGGTTTGGTT TTTTGATGGCAGTATAAGACCTGAGTTTATGACTCGGCAATTTCCTGTCCGGTTTGAGCCAGTGGGGCTCGCGTTTAATG GTGGGTTAGTGAGTGGTGGAAGTCAGAGTGACTCAGACTCGTCATCCGTCGTTGATGGCAAACCAGCAAGAGACTTCGAT CTTAATCTTCTTCCATCGGAGGAGGAAGATGCTTaaactttttctctttatacTTAATTGTTTAGGCAAATAACTAATTT CGTAAGGACTAATTAAGTAATTGTTTATCTTCCACAGAAGTAGGGAGAGGTTAAAAATGGTAATAATCTCGTTTAGTAGA TTATTACCGTTGGATGTAAATGATTTAGGATTAAGTTTTTTGCAACTAAAAAGAGGaatttaatcttaatttcTCCGGAG TTTTTCTCTTGTTGTAACCTTGCAATATTCGacagaattttcatttaatttttttttctataatgaaatagaaattgCTA ATGTTTATTCCTCCTT
Gene structure

JCDB Genes gff download

JCDBG25282 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG25282's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG25282JCDBG10058co-exp0.928967
JCDBG25282JCDBG02741co-exp0.918542
JCDBG25282JCDBG13994co-exp0.910286
JCDBG25282JCDBG07102co-exp0.909299
JCDBG25282JCDBG23512co-exp0.908027
JCDBG25282JCDBG08290co-exp0.900544
JCDBG25282JCDBG19825co-exp0.896027
JCDBG25282JCDBG03692co-exp0.891396
JCDBG25282JCDBG09465co-exp0.888534
JCDBG25282JCDBG11955co-exp0.883644
JCDBG10058JCDBG02741co-exp0.935702
JCDBG10058JCDBG13994co-exp0.909763
JCDBG10058JCDBG07102co-exp0.937065
JCDBG10058JCDBG23512co-exp0.861156
JCDBG10058JCDBG08290co-exp0.860719
JCDBG10058JCDBG19825co-exp0.858361
JCDBG10058JCDBG03692co-exp0.840088
JCDBG10058JCDBG09465co-exp0.86326
JCDBG10058JCDBG11955co-exp0.937108
JCDBG02741JCDBG13994co-exp0.919441
JCDBG02741JCDBG07102co-exp0.890461
JCDBG02741JCDBG23512co-exp0.873239
JCDBG02741JCDBG08290co-exp0.878459
JCDBG02741JCDBG19825co-exp0.864975
JCDBG02741JCDBG03692co-exp0.874068
JCDBG02741JCDBG09465co-exp0.886965
JCDBG02741JCDBG11955co-exp0.903312
JCDBG13994JCDBG07102co-exp0.892491
JCDBG13994JCDBG23512co-exp0.864105
JCDBG13994JCDBG08290co-exp0.855118
JCDBG13994JCDBG19825co-exp0.85821
JCDBG13994JCDBG03692co-exp0.883236
JCDBG13994JCDBG09465co-exp0.886927
JCDBG13994JCDBG11955co-exp0.861714
JCDBG07102JCDBG23512co-exp0.843692
JCDBG07102JCDBG08290co-exp0.868185
JCDBG07102JCDBG19825co-exp0.84824
JCDBG07102JCDBG03692co-exp0.817222
JCDBG07102JCDBG09465co-exp0.881739
JCDBG07102JCDBG11955co-exp0.89921
JCDBG23512JCDBG08290co-exp0.905793
JCDBG23512JCDBG19825co-exp0.903957
JCDBG23512JCDBG03692co-exp0.881003
JCDBG23512JCDBG09465co-exp0.879291
JCDBG23512JCDBG11955co-exp0.837031
JCDBG08290JCDBG19825co-exp0.845631
JCDBG08290JCDBG03692co-exp0.882418
JCDBG08290JCDBG09465co-exp0.866126
JCDBG08290JCDBG11955co-exp0.86355
JCDBG19825JCDBG03692co-exp0.87058
JCDBG19825JCDBG09465co-exp0.903368
JCDBG19825JCDBG11955co-exp0.8164
JCDBG03692JCDBG09465co-exp0.870268
JCDBG03692JCDBG11955co-exp0.823228
JCDBG09465JCDBG11955co-exp0.842096
PPI network
node1node2type
JCDBR33770
ID
JCDBR33770
Name
XM_012237636.1
Type
Scaffold
NW_012130064.1
Start
825649
End
826704
Strand
+
Exon
825649-826704
Sequence
CAACTTCATCTATAAAACGCGCTGCCCCTATTCCCGTCTCAACCCACCGCGTTGGGTAACCAAAACCGGCactcattatt ttcttctccGCTTCACCTAAACGACAACCAAAGATTCGAAATGGCTCCCAAAGAGAAGAGCATCGCCGCCTCCACTGGCC TCAAGAAAGGTACCATTACCAACAATAACGATAAGAAGGAAATGCATTACAGAGGAGTTAGAAAGAGGCCTTGGGGTCGT TACGCCGCCGAGATACGGGATCCGGGGAAGAAGAGCCGGGTCTGGTTAGGCACTTTTGATACGGCTGAGGAAGCTGCTAC AGCTTATGACAAGGCGGCGCGTGAATTCCGTGGCCCTAAGGCCAAGACTAACTTTCCTCTTCCCACCGAAATCACTCCGA TTAAAACCAAGGTCGCTAACTGCACTGATGACCCAAGTCCTAGCCAGAGCAGCACGGTTGAATCCTCCAGTCCGCCGGCT GCGCGTGAGATCACACACGACCTTGTGGAAAGGTTTCCGTTTGTTTATCAGCAGCAGAACGTGGTGGGTCCGGTTTGGTT TTTTGATGGCAGTATAAGACCTGAGTTTATGACTCGGCAATTTCCTGTCCGGTTTGAGCCAGTGGGGCTCGCGTTTAATG GTGGGTTAGTGAGTGGTGGAAGTCAGAGTGACTCAGACTCGTCATCCGTCGTTGATGGCAAACCAGCAAGAGACTTCGAT CTTAATCTTCTTCCATCGGAGGAGGAAGATGCTTaaactttttctctttatacTTAATTGTTTAGGCAAATAACTAATTT CGTAAGGACTAATTAAGTAATTGTTTATCTTCCACAGAAGTAGGGAGAGGTTAAAAATGGTAATAATCTCGTTTAGTAGA TTATTACCGTTGGATGTAAATGATTTAGGATTAAGTTTTTTGCAACTAAAAAGAGGaatttaatcttaatttcTCCGGAG TTTTTCTCTTGTTGTAACCTTGCAATATTCGacagaattttcatttaatttttttttctataatgaaatagaaattgCTA ATGTTTATTCCTCCTT
Product
ethylene-responsive transcription factor 4-like
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237636.1
JCDBP29701
ID
JCDBP29701
Parent
JCDBR33770
Name
XP_012093026.1
Scaffold
NW_012130064.1
CDS
825770-826405
Strand:
+
Sequence
MAPKEKSIAASTGLKKGTITNNNDKKEMHYRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTAEEAATAYDKAAREFRGPK AKTNFPLPTEITPIKTKVANCTDDPSPSQSSTVESSSPPAAREITHDLVERFPFVYQQQNVVGPVWFFDGSIRPEFMTRQ FPVRFEPVGLAFNGGLVSGGSQSDSDSSSVVDGKPARDFDLNLLPSEEEDA
Product
ethylene-responsive transcription factor 4-like
Source
Gnomon
Link
XP_012093026.1
InterProScan
IPR001471 AP2/ERF domain
IPR016177 DNA-binding domain
Pfam
PF00847.16 AP2 Domain