Detail information of JCDBG25284

JCDBG25284
ID
JCDBG25284
Name
LOC105650693
Type
protein_coding
Scaffold
NW_012130064.1
Start
838761
End
846877
Strand
+
Link
Genbank id:105650693 | Jatropha Genome Database ID:Jcr4S00006.260
Molecular function
GO:0005515 | protein binding
Cellular component
Biological process
KEGG
Entry: K11866
Name: STAMBP, AMSH
Definition: STAM-binding protein [EC:3.4.19.12]
ko04144:   Endocytosis
Source
Gnomon
TF
Description
AMSH-like
Sequence
ATATTTCAACAGAACCGTAGTTGGAGTGCATTCCCATGTTTACCCTTCTCACAAGCCAAATTGACCTGTTCTTTTATCGT GTCCCCTCCCCTTGTATTCGTCAGCTCCGAGCAGCCATTGACCACCTTTCTTTAAACGCCGGCCACTAGCACAGTTACCG ATCGGAGACTGGAGAAACAGATTTTCGTTTGCTTGACGAGAAAATAGATTGAAACGGACACGGAAATTTAAAggagaaat agaaaatgaggTCGGCATCTACTTGTGGTACAATAAACATCGCTGCTAGTGCTCAAAAACTCGATGTCGATAATCGGATT TCTCTCCGATACTATTACAGAATCGCTGATAATATTCTCAAACAGGTCTTGTTCTCATCTATATATCCATTGCTTGATAT TGTTTAtgataatttctcattttcggCTAGGGTTATAGGCGTGTATATAAATTTGGGCCTTTCTATTAAGGAAGCTTTGA TTACATTGTGATTGAAGTGTAAGTAGTCTTGAGCTGTTTTTGtgctttttagttttgttacATTTTACTTTTGTCTTGGT GAAAGTTGATAATTTAGGTTTGTTTGCTGCTGAACctaaaatgtgaaaatgagaattgattattgattgtctcaatttga ttatttactGTTGTTTTACGGATTGATACCAAGATGGTTGTTTTTTGAGAGCATTTTGATGTTTGGTGCATGCTAtgcct tttttcttttattgtgaTGGCAATTCAGTTTGGGActtcaattccttttttttcttttaaattgtatgaaaTTGTTAAGA GATTAACTACTGACTAAAGTTCTAGTTTAGTAATTGGTCTGATGAGGAGTGATACTGACTAGACTTGTTGAACAATAGAA AGGTGGGAAGAGAATGTGTATGCCTGCAGTTTACTAAATTAAGCGAATGCCACTTTATGTACTAAATTCAATTGTTTTCC TCCAGTAcctttaaaacaaattttagtCAAATGTGTTTGCATTCCTTCGCTGGTAGATCGTTTTTGTCGCCTCTGGCTTA ATAGCTCTAAGTGTGGTACATTCATCTAGCATCTCCATTGAAATGGGATGCATTTAGTATTTACCTTTGCTTTATGCTTG TTATGGACAGAAAGCACAGATATTACATCTAGTCTTCTACTGTTTTATCTGGCCTTTTTGCATCTTTTCCAGTTATTTAT GAATAATGTTGCAGTAGTTTCTGTATCCTTTTGCAATGTGCTCTAAATTCAATGTTCTAAAATTGTtaactttgattttt gttgCACTTTTTACATTGCAGGCTGACATCTTTcgagaagaaaataatattatagatCTGTATATTATGCTTTTAAGGTT TTCCAGGTGAGAGTAGGAGCTACGaattttgttgtaaaatttcaagaaGGGCGGGGAATTTCATTTTGGtgtaaaatttg atttggCATTAGTTTGTGTCTATGAAAAATGATGATCTATCATAACATTTTACTTTTACGCTGTACTTCTTTTTCTGTAG TTTGGTATCAGAAACAATACCACGTCATCGAGATTATGGGGCATCTCAACAAAGcaaaaaagttaatttgaaaaaggtaa tatcacttatttctttttctttttttttttttctccttgttagaatccatttctttttaaaattttggggttgatattga ttttaattaatttctttagaaattattaaatgctGTGAATGAGTTGGAGGATTTGAAGCCAGAAGTGCAGCAAAAGATCA ACGAATTTAACAGAAAACACACACATCAAGTAAATGGGAGGGACTATTTCCTGCAAAATGATTCATTAGAGTGGCCTcct gttaaaaagaaaaccttGACTAGCTATAATGGGATAAAGGTATTGTTAAAGCTCCATATTGGTTGATAGCTACTGCTTGC TAGTTTCAACAACTTGTGATCAACTGTGTTGCTAGGCAGAATTCTCCTTTGTTACTCTTTTAATCAACTGATACTTTTGC TTTATCTGCTTTATGGGGATTAACTTATGTTCCTGTACTACTCTGGATTTACAGGCTCTGAGGCCGCCTACACGAGAATT TGTTTCTCAAGGTTCAAGAACTCAGCAATTTTCATATGCTAGACCAGTGGAAGAGCAGTTCCGGAGAATGTAAGTGCTTC AATACAAGATGTGGTTCTCCTTCAAATAGAAGGGTTTTCCTCCCACTTCTTGAGTATGCCACTAGTATATCTTCATTAGT GACTTTTTGCTTTGCAAAAATGTTATGTTTTTTGGTTGTGTCTGAATAAAACAAATTCTTTGGTGCTTTACAATTAGAAT AGCCTTTTTCTTTGAAGAATTGTTTAAATCCTTACTTTTAAACCTTTCATTTGAATGACAATAAGGGACCAGGACATTTT TTTACGTGAATTTTTGATGTTAAGAGTACAGTCTATAAAGCTTGGAATTATCACCCCTTTGACTTCAGTTTCAAAAGGTT TAAGCATCTCTAAGTTCTTGCTTGCGGCCATTAAACTTTATCTCTCCTTTAGTCCCTATATTACGCATTCTTAAGTATTA ACTTTCAGTTCCGTTGAGACATTAAATGGTGATGCATCTGTTGGGAGTGCatggtaaaatttaattgttgttaTTTAACT TATCACTATTGTATATTAATTTCACTAAACTTTAATTTGTCTCTTAAAAATCTGTGGACCTTTACTGAGGTAtcaaatat caattatataattgaGACTTAATTCTGGCCAAATATCTGCCAGAAAGCTGACATAGACAACAGACCCTATTTTTGACACA AAAGTGGGACACCTCAACACAActttttctctcctctctttaCCCACTTACACAAACTCTTCTTTACTGCTGACCACCCC TTCTGTTGTTCTCCGTCTTTGttgaaataagagaaaatttggCTTATTTTTCATAGGGcatttttaggaaaaataaatat agttttacAGATATGATGCTTAATCGAAATCTTTTGAACTTTAGGCACTAATTTATGATGTTctaattatgagatttatt tgcaaattaaatgaattccttattctttgtttcaaaatcagaaagtgcaaaaaaaatgttttaagtCTTCATTGCCAact aaatttacaaatatattctAATGGCAACTGGGAGATGATGCTTCAGCCTATAAACATTTCAAGCTAAATTATACTGAAGA GCAGAGATTATAAATTTCGGAGGATGGATTCCCTGCCACAAGGGCTCCGATATGCTATGTGTATTAATATGCATGTTTTT CTGTTGGGACATGGATACACGTATTATTAGTTACTCTGAATACTACATAATATGAAGTGCCAGTcagtttttaactttta gtaCATTGAGATCCTTATTGGGTGTACAGCTTTCAGTTTGAAATTCTAGTCAGTTTCTAAATTGGCAGTTTGGTGACCCT CCCAAGCTCAGACTTTCAGGGAGGCCTAATTAGGTGATTCTGTAAACATGAGGTTGATGATAGAGACAACTTGGTTTATA GGAAGGGCATGAAATGAGCCTATAATTCCAAgagatattattttgtttcttctgtCTGTCCGTCTGTtcattagaattaa ttaattaactaacttCAATGCCTGAGTCAATGaggatttgattttgactTATACGCGTCCTTTGCTATCCTGTACTTCTT TACAAGTCGACTCACTTCTTGCAGATCTTTAAACTTCCCACGTCCAAAGGAGGAGACTCTCTCCAGACATTCTATACTGG GTCCAAATGGGCTTCATGGGCAGTGGCAACCACCTAGGAGTGACAAAGGAGTATGATGTTATccatctttttgttttttg ttccTTCAGGCAAAGTTTGTGCTAATCTATTTCATGTGAAAGCAGGTTCAGTATCCAAGCTATGTGGACCTCACTCCAAT AGAAATCCCAAGGTTTGACTCTTCTCTAGCTTTTGaagtatattttaattgctgTTTTGGATTTCAATAGATTGACTGAC GATAATGGGAGTTTCAATAAAAGTTATCGTTTGAAGTCATCATGTGGTTTGATGATGTTGATTTGTTTCAAGTTGTTTCT TCTGAAGAAACTTCTATTATATTGTTGTTTCATATTTTgctgcctttttttttttttttttttcttttgtggttTTGGAT TCTTTTTGATGGGTGGATCTACATTCGGAACCAGCCTGCAGCAATCTACAGAAAATGCAGTTACAGTGAATAAGAACTAC AGCAATTCAGAACACAATAACCTTCAAAAATCGATCGAAAATGGATTTACATTAAAATCAGACAGCAGCAGCCCAGAGCC TGAAAGATCAAGTTTAGAATCAGTTGTTTCTGTTAGTGATGATAGTCAGATGCACCAAACTGAAGAACCTGCTTCCATGA TTTCCTTTGAGACAATTGAAATCCCTGTTCAGACAGATCTGATTAGACAACCTTCTCCTCCAGCTGTGCTTGCTGAAGTA CAAGATTTGATACCTTCATTGTCGCCCCAAGTTACTGAAGCAGAGCATAAAATGGACATTTCCTCACCTAATGATTTTGT TCATTCTGAATCTCCCCTGCAATTGCACATTGTAAGCTCCTCAAGAACATTGTTCTTTACAATTTTACTGTCCTATTTTT TGCAGTTAGTCAGGAATCTTGCTGATGGAAATTGTTATTCATTACGTGTCATGCAACTTTGTCcatctttaaaattttgg gaCCCTGTATTTGTCTGTTTGTTTTCTCAAGCTAAGTATTTGTGATCTACTAGCTTATCCAGGAGTAATGTGgttagcaa aagaaaataagggTGTTTGTGGGAAGGTTATGTCAACTTGTATATTCTCCAAGCTTTATGAAGGCACTGTTGCCTTAAGA AGTTGGAATACTGGAGTGTGAGAAAAGCAATGGAAGGGGAGGAGATATTGGTTTCTGGTCATGTACTAACTGCTTGTTTC TTTGCAGTCAACCACGATGATGGAGAATTTCATGAAGTTGGCAAAGTCAAATACCGATAAACATTTAGAAACTTGTGGTG TCCTAGCTGGTTCTCTTGTAAGTTCTGATAACCTAAAAACTACTGTTTTTTAtctttgcaattttttatgCTGATGGTTC AATTAATTACCACTTTGTAGAAAAACAGAAAGTTCTATGTTACAGCTCTCATTATTCCAAAGCAGGAATCTACATCAGAT TCGGTATGGCAGTTTATTTAAACATTGAGGAtagttttttcatatttatttattaattacatagATTTGATTGCCATTTA AATGCACACTTTCTTACCAGTGTCAGACTACAAATGAAGAGGAAATATTTGAAGTACAGGATAAGCGATCTCTATTTCCT CTCGGGTGGATTCATGTGAGTAAAAGTGTCCATTAATATACTTTTGCTTATCTGTCGCTTCTGGTATAAAATGAGATGAG CCTTTCCTTTGGTATGGGACTATCAAGCTTTCTTGCCATGCTAACTATGAGTACagaaataaaagtttattCTGCAATTA TCTATCTGTATGTGTATGTTTCTTGTCTGATCTAAATTTAACATTACCCTGCCAACTTTAGTTTTGCATTGATGCTGATT AAGTTCTTCTCAGTTTCATGTGTACTTGATGCCattattattacttcaatcgttatgatttttatttgtctGCTGGGATT TCCTTACTTGGATGTTATTGGATCCTGAATCAAGACTCAGTGTTGGAGTAACTTTAGAGTCTGAAGATTTCAggttaaac ataattaaaatggaCTATACATTTAATAGTGCCAGTTGTGGATAAGTGAAGGATATTAGATCAGAGGGAGTAGAGCTGCC TTGGTGTGCTCATTTTGGAGACTTCAGTTCCATATGAAAAGATGGGGAATATGGTGGGAAGATGTTAATGCATAGAACTG AAAGCAAGACAGGTGGTTGAATTGGCTGTTGTTGGGGTGCTTTGTACAAAAACCACTAGTTATGCTGAAGAGTAAATTCT ATAAAACCGCTATCGGACTGACTGCCCTCTACTTAAAAGAGCCGTGATCAAATGAAGGGCTACATGACAAATGGCAATTT CTGGAAATTGCAAGTGACAGAGAAGGTGAACATATTACTATGCATTAATGTTCTGGAAATTGGGGGCAGCTTAGCTTCCT GAAATGGTTTAGCCTTTCTAATATTCGACCTATGGATCTGACTGTGTAAAAAAGTGGATGAATTGTAGTGGTATGAATGA GTATGTTGGTCCGAAGATGATTTAAGTTAAGATCCATCATATAGCAGGAGTGTGGGAAAAACATCACTGTTAACAATGAT AAGAAGAAGCAGGTCTTGAACTGTTTACTTATGTGTGCTATAGTCAGGGCACGATTCTGAGAAACATCatttgttaatat ttatttgcgGCAAAAATAATGTCAAAGATGCTGCTTGTGGGATCTTGATACTGTTTTAATTTAGTCATGTGAGAATTTGC ATTTGGATAACTTGTATTACACTCAAGTTTACTTTGCAATTGGTGAAACTCTGTGAAACAAATAAATGCTTATATATCAT TTAGAGTTTAATTCTCACTACAAagttttttttgatttatatattttctcagtcactattaaaaaattttcttctgaCTT GCTGGTTTCTCCCCATGCTGCAAATTCCAGACACATCCTACACAGTCTTGTTTCATGTCATCAATTGATCTTCACACCCA TTATTCCTATCAGGTGATTGGCTCTTCCTGTTATTTTATAGTTCACTCTCATTGCAGAGGAAGTCATATTACATAATGTT CTTGTTGGTTAATTATTTGAAGTGGTTCAGTAGAAGTGGGAGTCATATATATAGCGCCTTTACATCATCAAAGGCCATGA TTTATGCAATTATTGAGAAAGTAATCACTTTATAGCTTAATCAGTTGGATAGTTAGAGCAATCATAAAGGTGCTACATAA ATGTGAATGGTGTATAATGTATCTGAGAGTATCTTTTTACCTTACATTCAGTAGTTTTTCATTCTATCCAGTTTTTTGGC TTGATTTTTTTGTCAGATTAGATAATGCAGCGGCCAATTTTGATCTAGTTTTTTCCATTGCCTGTTTCCATCAGTTAGTT CTTTTGTtgatcattttctttattgttcaTTTATACGATTTTTCATTCCTCAGATAATGTTGCCAGAATCTGTTGCCATT GTCATGGCACCAAGAGATACTTCAAGGTAACTTTTTgtgttattaaatttcaactttttgcAATTATGtcaacttaatta tatatatatttggtgCAGAAAACATGGCATTTTTCGGTTGACATCCCCTGGTGGCATGTCCGTTATAAGACACTGCCAGC AACGTGGATTTCATCCACATGATCAACCTCCAGATGGTGGGCCGATTTACAACACCTGTACAGATGTCTATATGAATCCC AACCTAAAGTTTGATGTTATTGACCTACGATAATCTTGTTCCAATCTCAAGCAATCTATAATGTTTTGGCAATGCAATTG TTCATAAACCATCAATTTATGGTGAGTGGCTTTACCATTTATGTGTTCcttattaaattgtaaagAAGTGAATATATTAC AACTGCCTGTATACTGATACGAATCAGTCTATTTGAACTGGAAAAATACACGTTCAAACTTTTCCAGCGAGGACTCAGTC CCCTTGCTGGTTTATGACCGTTACATCCCTGCATGCACATATGCATGCATATGTACATGCTGGCTCAAATGCATTTACAA GCTTGATATGCTCCTGCAAACTGGGGCAGGGGGCGGCTAGTGGTTCTAGtggttctttcttttttaaaagaatcCAGTTC AGAATTGAGTGGTTCTAGCTGGTTCAAGTGGTTTCAAAGTAGTTTCCAGCTAGTTCTGGGTTCCGATAGCCCTTGACTGT CTGGTGTGAACATCAGGAAAATGAAAGCTCAAGGAAGAAAGCAGTTAAGCAAACATGGAGAAATCATGAAAAGAAATGGA GTGATGTAAAAGCAAAAGGtgagataataataatctcCACAGAATGTGTGCATTGGGAAATCAGCTTTGGTGGGTGGGTG GACTCTTTTAGGaatggatttatttttcctttctaat
Gene structure

JCDB Genes gff download

JCDBG25284 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG25284's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG25284JCDBG03328co-exp0.861231
JCDBG25284JCDBG22791co-exp0.856905
JCDBG25284JCDBG17560co-exp0.856832
JCDBG25284JCDBG21285co-exp0.855916
JCDBG25284JCDBG08633co-exp0.848707
JCDBG25284JCDBG13800co-exp0.845322
JCDBG25284JCDBG15966co-exp0.843535
JCDBG25284JCDBG06343co-exp0.838173
JCDBG25284JCDBG23071co-exp0.835619
JCDBG25284JCDBG22326co-exp0.831969
JCDBG03328JCDBG22791co-exp0.842581
JCDBG03328JCDBG17560co-exp0.84684
JCDBG03328JCDBG21285co-exp0.883676
JCDBG03328JCDBG08633co-exp0.935376
JCDBG03328JCDBG13800co-exp0.947815
JCDBG03328JCDBG15966co-exp0.852741
JCDBG03328JCDBG06343co-exp0.93528
JCDBG03328JCDBG23071co-exp0.829222
JCDBG03328JCDBG22326co-exp0.861342
JCDBG22791JCDBG17560co-exp0.828173
JCDBG22791JCDBG21285co-exp0.845073
JCDBG22791JCDBG08633co-exp0.828093
JCDBG22791JCDBG13800co-exp0.827698
JCDBG22791JCDBG15966co-exp0.833011
JCDBG22791JCDBG06343co-exp0.82057
JCDBG22791JCDBG23071co-exp0.805862
JCDBG22791JCDBG22326co-exp0.788013
JCDBG17560JCDBG21285co-exp0.817889
JCDBG17560JCDBG08633co-exp0.845103
JCDBG17560JCDBG13800co-exp0.855029
JCDBG17560JCDBG15966co-exp0.764564
JCDBG17560JCDBG06343co-exp0.827401
JCDBG17560JCDBG23071co-exp0.879333
JCDBG17560JCDBG22326co-exp0.828411
JCDBG21285JCDBG08633co-exp0.859936
JCDBG21285JCDBG13800co-exp0.884403
JCDBG21285JCDBG15966co-exp0.795931
JCDBG21285JCDBG06343co-exp0.847563
JCDBG21285JCDBG23071co-exp0.88126
JCDBG21285JCDBG22326co-exp0.83376
JCDBG08633JCDBG13800co-exp0.937189
JCDBG08633JCDBG15966co-exp0.856278
JCDBG08633JCDBG06343co-exp0.945084
JCDBG08633JCDBG23071co-exp0.832144
JCDBG08633JCDBG22326co-exp0.847846
JCDBG13800JCDBG15966co-exp0.828418
JCDBG13800JCDBG06343co-exp0.929756
JCDBG13800JCDBG23071co-exp0.856586
JCDBG13800JCDBG22326co-exp0.862459
JCDBG15966JCDBG06343co-exp0.863403
JCDBG15966JCDBG23071co-exp0.768488
JCDBG15966JCDBG22326co-exp0.748781
JCDBG06343JCDBG23071co-exp0.835602
JCDBG06343JCDBG22326co-exp0.838841
JCDBG23071JCDBG22326co-exp0.814062
PPI network
node1node2type
JCDBG25284JCDBG18767PPI
JCDBG25284JCDBG03034PPI
JCDBG25284JCDBG08229PPI
JCDBG25284JCDBG00858PPI
JCDBG25284JCDBG22402PPI
JCDBG25284JCDBG24486PPI
JCDBG25284JCDBG23558PPI
JCDBG25284JCDBG10237PPI
JCDBG25284JCDBG07433PPI
JCDBG08229JCDBG22402PPI
JCDBG24486JCDBG23558PPI
JCDBR33772
ID
JCDBR33772
Name
XM_012237638.1
Type
Scaffold
NW_012130064.1
Start
838761
End
846877
Strand
+
Exon
838761-839126,840063-840127,840282-840357,840461-840640,840816-840910,842466-842571,842647-842693,842956-843352,843729-843818,843902-843964,844062-844136,845432-845494,845935-845987,846060-846877
Sequence
ATATTTCAACAGAACCGTAGTTGGAGTGCATTCCCATGTTTACCCTTCTCACAAGCCAAATTGACCTGTTCTTTTATCGT GTCCCCTCCCCTTGTATTCGTCAGCTCCGAGCAGCCATTGACCACCTTTCTTTAAACGCCGGCCACTAGCACAGTTACCG ATCGGAGACTGGAGAAACAGATTTTCGTTTGCTTGACGAGAAAATAGATTGAAACGGACACGGAAATTTAAAggagaaat agaaaatgaggTCGGCATCTACTTGTGGTACAATAAACATCGCTGCTAGTGCTCAAAAACTCGATGTCGATAATCGGATT TCTCTCCGATACTATTACAGAATCGCTGATAATATTCTCAAACAGGTCTTGTTCTCATCTATATATCCATTGCTTGATAT TGTTTAtgataatttctcattttcggCTAGGGTTATAGGCGTGTATATAAATTTGGGCCTTTCTATTAAGGAAGCTTTGA TTACATTGTGATTGAAGTGTAAGTAGTCTTGAGCTGTTTTTGtgctttttagttttgttacATTTTACTTTTGTCTTGGT GAAAGTTGATAATTTAGGTTTGTTTGCTGCTGAACctaaaatgtgaaaatgagaattgattattgattgtctcaatttga ttatttactGTTGTTTTACGGATTGATACCAAGATGGTTGTTTTTTGAGAGCATTTTGATGTTTGGTGCATGCTAtgcct tttttcttttattgtgaTGGCAATTCAGTTTGGGActtcaattccttttttttcttttaaattgtatgaaaTTGTTAAGA GATTAACTACTGACTAAAGTTCTAGTTTAGTAATTGGTCTGATGAGGAGTGATACTGACTAGACTTGTTGAACAATAGAA AGGTGGGAAGAGAATGTGTATGCCTGCAGTTTACTAAATTAAGCGAATGCCACTTTATGTACTAAATTCAATTGTTTTCC TCCAGTAcctttaaaacaaattttagtCAAATGTGTTTGCATTCCTTCGCTGGTAGATCGTTTTTGTCGCCTCTGGCTTA ATAGCTCTAAGTGTGGTACATTCATCTAGCATCTCCATTGAAATGGGATGCATTTAGTATTTACCTTTGCTTTATGCTTG TTATGGACAGAAAGCACAGATATTACATCTAGTCTTCTACTGTTTTATCTGGCCTTTTTGCATCTTTTCCAGTTATTTAT GAATAATGTTGCAGTAGTTTCTGTATCCTTTTGCAATGTGCTCTAAATTCAATGTTCTAAAATTGTtaactttgattttt gttgCACTTTTTACATTGCAGGCTGACATCTTTcgagaagaaaataatattatagatCTGTATATTATGCTTTTAAGGTT TTCCAGGTGAGAGTAGGAGCTACGaattttgttgtaaaatttcaagaaGGGCGGGGAATTTCATTTTGGtgtaaaatttg atttggCATTAGTTTGTGTCTATGAAAAATGATGATCTATCATAACATTTTACTTTTACGCTGTACTTCTTTTTCTGTAG TTTGGTATCAGAAACAATACCACGTCATCGAGATTATGGGGCATCTCAACAAAGcaaaaaagttaatttgaaaaaggtaa tatcacttatttctttttctttttttttttttctccttgttagaatccatttctttttaaaattttggggttgatattga ttttaattaatttctttagaaattattaaatgctGTGAATGAGTTGGAGGATTTGAAGCCAGAAGTGCAGCAAAAGATCA ACGAATTTAACAGAAAACACACACATCAAGTAAATGGGAGGGACTATTTCCTGCAAAATGATTCATTAGAGTGGCCTcct gttaaaaagaaaaccttGACTAGCTATAATGGGATAAAGGTATTGTTAAAGCTCCATATTGGTTGATAGCTACTGCTTGC TAGTTTCAACAACTTGTGATCAACTGTGTTGCTAGGCAGAATTCTCCTTTGTTACTCTTTTAATCAACTGATACTTTTGC TTTATCTGCTTTATGGGGATTAACTTATGTTCCTGTACTACTCTGGATTTACAGGCTCTGAGGCCGCCTACACGAGAATT TGTTTCTCAAGGTTCAAGAACTCAGCAATTTTCATATGCTAGACCAGTGGAAGAGCAGTTCCGGAGAATGTAAGTGCTTC AATACAAGATGTGGTTCTCCTTCAAATAGAAGGGTTTTCCTCCCACTTCTTGAGTATGCCACTAGTATATCTTCATTAGT GACTTTTTGCTTTGCAAAAATGTTATGTTTTTTGGTTGTGTCTGAATAAAACAAATTCTTTGGTGCTTTACAATTAGAAT AGCCTTTTTCTTTGAAGAATTGTTTAAATCCTTACTTTTAAACCTTTCATTTGAATGACAATAAGGGACCAGGACATTTT TTTACGTGAATTTTTGATGTTAAGAGTACAGTCTATAAAGCTTGGAATTATCACCCCTTTGACTTCAGTTTCAAAAGGTT TAAGCATCTCTAAGTTCTTGCTTGCGGCCATTAAACTTTATCTCTCCTTTAGTCCCTATATTACGCATTCTTAAGTATTA ACTTTCAGTTCCGTTGAGACATTAAATGGTGATGCATCTGTTGGGAGTGCatggtaaaatttaattgttgttaTTTAACT TATCACTATTGTATATTAATTTCACTAAACTTTAATTTGTCTCTTAAAAATCTGTGGACCTTTACTGAGGTAtcaaatat caattatataattgaGACTTAATTCTGGCCAAATATCTGCCAGAAAGCTGACATAGACAACAGACCCTATTTTTGACACA AAAGTGGGACACCTCAACACAActttttctctcctctctttaCCCACTTACACAAACTCTTCTTTACTGCTGACCACCCC TTCTGTTGTTCTCCGTCTTTGttgaaataagagaaaatttggCTTATTTTTCATAGGGcatttttaggaaaaataaatat agttttacAGATATGATGCTTAATCGAAATCTTTTGAACTTTAGGCACTAATTTATGATGTTctaattatgagatttatt tgcaaattaaatgaattccttattctttgtttcaaaatcagaaagtgcaaaaaaaatgttttaagtCTTCATTGCCAact aaatttacaaatatattctAATGGCAACTGGGAGATGATGCTTCAGCCTATAAACATTTCAAGCTAAATTATACTGAAGA GCAGAGATTATAAATTTCGGAGGATGGATTCCCTGCCACAAGGGCTCCGATATGCTATGTGTATTAATATGCATGTTTTT CTGTTGGGACATGGATACACGTATTATTAGTTACTCTGAATACTACATAATATGAAGTGCCAGTcagtttttaactttta gtaCATTGAGATCCTTATTGGGTGTACAGCTTTCAGTTTGAAATTCTAGTCAGTTTCTAAATTGGCAGTTTGGTGACCCT CCCAAGCTCAGACTTTCAGGGAGGCCTAATTAGGTGATTCTGTAAACATGAGGTTGATGATAGAGACAACTTGGTTTATA GGAAGGGCATGAAATGAGCCTATAATTCCAAgagatattattttgtttcttctgtCTGTCCGTCTGTtcattagaattaa ttaattaactaacttCAATGCCTGAGTCAATGaggatttgattttgactTATACGCGTCCTTTGCTATCCTGTACTTCTT TACAAGTCGACTCACTTCTTGCAGATCTTTAAACTTCCCACGTCCAAAGGAGGAGACTCTCTCCAGACATTCTATACTGG GTCCAAATGGGCTTCATGGGCAGTGGCAACCACCTAGGAGTGACAAAGGAGTATGATGTTATccatctttttgttttttg ttccTTCAGGCAAAGTTTGTGCTAATCTATTTCATGTGAAAGCAGGTTCAGTATCCAAGCTATGTGGACCTCACTCCAAT AGAAATCCCAAGGTTTGACTCTTCTCTAGCTTTTGaagtatattttaattgctgTTTTGGATTTCAATAGATTGACTGAC GATAATGGGAGTTTCAATAAAAGTTATCGTTTGAAGTCATCATGTGGTTTGATGATGTTGATTTGTTTCAAGTTGTTTCT TCTGAAGAAACTTCTATTATATTGTTGTTTCATATTTTgctgcctttttttttttttttttttcttttgtggttTTGGAT TCTTTTTGATGGGTGGATCTACATTCGGAACCAGCCTGCAGCAATCTACAGAAAATGCAGTTACAGTGAATAAGAACTAC AGCAATTCAGAACACAATAACCTTCAAAAATCGATCGAAAATGGATTTACATTAAAATCAGACAGCAGCAGCCCAGAGCC TGAAAGATCAAGTTTAGAATCAGTTGTTTCTGTTAGTGATGATAGTCAGATGCACCAAACTGAAGAACCTGCTTCCATGA TTTCCTTTGAGACAATTGAAATCCCTGTTCAGACAGATCTGATTAGACAACCTTCTCCTCCAGCTGTGCTTGCTGAAGTA CAAGATTTGATACCTTCATTGTCGCCCCAAGTTACTGAAGCAGAGCATAAAATGGACATTTCCTCACCTAATGATTTTGT TCATTCTGAATCTCCCCTGCAATTGCACATTGTAAGCTCCTCAAGAACATTGTTCTTTACAATTTTACTGTCCTATTTTT TGCAGTTAGTCAGGAATCTTGCTGATGGAAATTGTTATTCATTACGTGTCATGCAACTTTGTCcatctttaaaattttgg gaCCCTGTATTTGTCTGTTTGTTTTCTCAAGCTAAGTATTTGTGATCTACTAGCTTATCCAGGAGTAATGTGgttagcaa aagaaaataagggTGTTTGTGGGAAGGTTATGTCAACTTGTATATTCTCCAAGCTTTATGAAGGCACTGTTGCCTTAAGA AGTTGGAATACTGGAGTGTGAGAAAAGCAATGGAAGGGGAGGAGATATTGGTTTCTGGTCATGTACTAACTGCTTGTTTC TTTGCAGTCAACCACGATGATGGAGAATTTCATGAAGTTGGCAAAGTCAAATACCGATAAACATTTAGAAACTTGTGGTG TCCTAGCTGGTTCTCTTGTAAGTTCTGATAACCTAAAAACTACTGTTTTTTAtctttgcaattttttatgCTGATGGTTC AATTAATTACCACTTTGTAGAAAAACAGAAAGTTCTATGTTACAGCTCTCATTATTCCAAAGCAGGAATCTACATCAGAT TCGGTATGGCAGTTTATTTAAACATTGAGGAtagttttttcatatttatttattaattacatagATTTGATTGCCATTTA AATGCACACTTTCTTACCAGTGTCAGACTACAAATGAAGAGGAAATATTTGAAGTACAGGATAAGCGATCTCTATTTCCT CTCGGGTGGATTCATGTGAGTAAAAGTGTCCATTAATATACTTTTGCTTATCTGTCGCTTCTGGTATAAAATGAGATGAG CCTTTCCTTTGGTATGGGACTATCAAGCTTTCTTGCCATGCTAACTATGAGTACagaaataaaagtttattCTGCAATTA TCTATCTGTATGTGTATGTTTCTTGTCTGATCTAAATTTAACATTACCCTGCCAACTTTAGTTTTGCATTGATGCTGATT AAGTTCTTCTCAGTTTCATGTGTACTTGATGCCattattattacttcaatcgttatgatttttatttgtctGCTGGGATT TCCTTACTTGGATGTTATTGGATCCTGAATCAAGACTCAGTGTTGGAGTAACTTTAGAGTCTGAAGATTTCAggttaaac ataattaaaatggaCTATACATTTAATAGTGCCAGTTGTGGATAAGTGAAGGATATTAGATCAGAGGGAGTAGAGCTGCC TTGGTGTGCTCATTTTGGAGACTTCAGTTCCATATGAAAAGATGGGGAATATGGTGGGAAGATGTTAATGCATAGAACTG AAAGCAAGACAGGTGGTTGAATTGGCTGTTGTTGGGGTGCTTTGTACAAAAACCACTAGTTATGCTGAAGAGTAAATTCT ATAAAACCGCTATCGGACTGACTGCCCTCTACTTAAAAGAGCCGTGATCAAATGAAGGGCTACATGACAAATGGCAATTT CTGGAAATTGCAAGTGACAGAGAAGGTGAACATATTACTATGCATTAATGTTCTGGAAATTGGGGGCAGCTTAGCTTCCT GAAATGGTTTAGCCTTTCTAATATTCGACCTATGGATCTGACTGTGTAAAAAAGTGGATGAATTGTAGTGGTATGAATGA GTATGTTGGTCCGAAGATGATTTAAGTTAAGATCCATCATATAGCAGGAGTGTGGGAAAAACATCACTGTTAACAATGAT AAGAAGAAGCAGGTCTTGAACTGTTTACTTATGTGTGCTATAGTCAGGGCACGATTCTGAGAAACATCatttgttaatat ttatttgcgGCAAAAATAATGTCAAAGATGCTGCTTGTGGGATCTTGATACTGTTTTAATTTAGTCATGTGAGAATTTGC ATTTGGATAACTTGTATTACACTCAAGTTTACTTTGCAATTGGTGAAACTCTGTGAAACAAATAAATGCTTATATATCAT TTAGAGTTTAATTCTCACTACAAagttttttttgatttatatattttctcagtcactattaaaaaattttcttctgaCTT GCTGGTTTCTCCCCATGCTGCAAATTCCAGACACATCCTACACAGTCTTGTTTCATGTCATCAATTGATCTTCACACCCA TTATTCCTATCAGGTGATTGGCTCTTCCTGTTATTTTATAGTTCACTCTCATTGCAGAGGAAGTCATATTACATAATGTT CTTGTTGGTTAATTATTTGAAGTGGTTCAGTAGAAGTGGGAGTCATATATATAGCGCCTTTACATCATCAAAGGCCATGA TTTATGCAATTATTGAGAAAGTAATCACTTTATAGCTTAATCAGTTGGATAGTTAGAGCAATCATAAAGGTGCTACATAA ATGTGAATGGTGTATAATGTATCTGAGAGTATCTTTTTACCTTACATTCAGTAGTTTTTCATTCTATCCAGTTTTTTGGC TTGATTTTTTTGTCAGATTAGATAATGCAGCGGCCAATTTTGATCTAGTTTTTTCCATTGCCTGTTTCCATCAGTTAGTT CTTTTGTtgatcattttctttattgttcaTTTATACGATTTTTCATTCCTCAGATAATGTTGCCAGAATCTGTTGCCATT GTCATGGCACCAAGAGATACTTCAAGGTAACTTTTTgtgttattaaatttcaactttttgcAATTATGtcaacttaatta tatatatatttggtgCAGAAAACATGGCATTTTTCGGTTGACATCCCCTGGTGGCATGTCCGTTATAAGACACTGCCAGC AACGTGGATTTCATCCACATGATCAACCTCCAGATGGTGGGCCGATTTACAACACCTGTACAGATGTCTATATGAATCCC AACCTAAAGTTTGATGTTATTGACCTACGATAATCTTGTTCCAATCTCAAGCAATCTATAATGTTTTGGCAATGCAATTG TTCATAAACCATCAATTTATGGTGAGTGGCTTTACCATTTATGTGTTCcttattaaattgtaaagAAGTGAATATATTAC AACTGCCTGTATACTGATACGAATCAGTCTATTTGAACTGGAAAAATACACGTTCAAACTTTTCCAGCGAGGACTCAGTC CCCTTGCTGGTTTATGACCGTTACATCCCTGCATGCACATATGCATGCATATGTACATGCTGGCTCAAATGCATTTACAA GCTTGATATGCTCCTGCAAACTGGGGCAGGGGGCGGCTAGTGGTTCTAGtggttctttcttttttaaaagaatcCAGTTC AGAATTGAGTGGTTCTAGCTGGTTCAAGTGGTTTCAAAGTAGTTTCCAGCTAGTTCTGGGTTCCGATAGCCCTTGACTGT CTGGTGTGAACATCAGGAAAATGAAAGCTCAAGGAAGAAAGCAGTTAAGCAAACATGGAGAAATCATGAAAAGAAATGGA GTGATGTAAAAGCAAAAGGtgagataataataatctcCACAGAATGTGTGCATTGGGAAATCAGCTTTGGTGGGTGGGTG GACTCTTTTAGGaatggatttatttttcctttctaat
Product
AMSH-like ubiquitin thioesterase 1
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237638.1
JCDBP29703
ID
JCDBP29703
Parent
JCDBR33772
Name
XP_012093028.1
Scaffold
NW_012130064.1
CDS
839007-839126,840063-840127,840282-840357,840461-840640,840816-840910,842466-842571,842647-842693,842956-843352,843729-843818,843902-843964,844062-844136,845432-845494,845935-845987,846060-846234
Strand:
+
Sequence
MRSASTCGTINIAASAQKLDVDNRISLRYYYRIADNILKQADIFREENNIIDLYIMLLRFSSLVSETIPRHRDYGASQQS KKVNLKKKLLNAVNELEDLKPEVQQKINEFNRKHTHQVNGRDYFLQNDSLEWPPVKKKTLTSYNGIKALRPPTREFVSQG SRTQQFSYARPVEEQFRRISLNFPRPKEETLSRHSILGPNGLHGQWQPPRSDKGVQYPSYVDLTPIEIPSLQQSTENAVT VNKNYSNSEHNNLQKSIENGFTLKSDSSSPEPERSSLESVVSVSDDSQMHQTEEPASMISFETIEIPVQTDLIRQPSPPA VLAEVQDLIPSLSPQVTEAEHKMDISSPNDFVHSESPLQLHISTTMMENFMKLAKSNTDKHLETCGVLAGSLKNRKFYVT ALIIPKQESTSDSCQTTNEEEIFEVQDKRSLFPLGWIHTHPTQSCFMSSIDLHTHYSYQIMLPESVAIVMAPRDTSRKHG IFRLTSPGGMSVIRHCQQRGFHPHDQPPDGGPIYNTCTDVYMNPNLKFDVIDLR
Product
AMSH-like ubiquitin thioesterase 1
Source
Gnomon
Link
XP_012093028.1
InterProScan
IPR000555 JAB1/MPN/MOV34 metalloenzyme domain
IPR015063 USP8 dimerisation domain
Pfam
PF08969.7 USP8_dimer Domain
PF01398.17 JAB Family