Detail information of JCDBG25285

JCDBG25285
ID
JCDBG25285
Name
LOC105650726
Type
protein_coding
Scaffold
NW_012130064.1
Start
852595
End
853383
Strand
+
Link
Genbank id:105650726 | Jatropha Genome Database ID:Jcr4S00006.270
Molecular function
Cellular component
Biological process
KEGG
Source
Gnomon
TF
Description
rho
Sequence
TGTGTTCAGAAACAAGCCCTCGTATATCATTCTCTAATGATCTTGCTCATGGCGATGGCACAGAAAACGAGCACGTGCCT AGAAGAGACACAACGCTCCTTGAATCAAATTCCGACTTCGAATTCAACATCTCCAGTCGTCTGCTAGATTATGAATCTTC TTTGGCAGATGAGCTTTTCTCCAATGGCATGTTACTTCCTTTCCAAGATAATAAACAAGAAACTTCTCCAAACGTTTCTC AAAATATTTCACGAAACGTTTCACGACATGTTTCTCTCCTTCctcttccttctccttcttgtTCCACTCTTACCAGTTCT TCAAattcaagaaagaaattgaGTAATACTGAAATTAGGGTTTCGAATTCGGAATTGGAAGAAAAGGCAGAgccaaaatc aacattttggGGATTCAAGAGAAGTAATAGTCTAAACTGTGATCTAAAGAAAGGTTCAATTTTTTCATTGCCAGTTTTGT CAAGAAGCAATTCAACTGGAACAGCAGCGCCAAATTCAAAGAGATCATCAATGGCAAAGAAGTTATTACCATCAACATCT TCTGGTTCTTCTACTAATTATGTGTACACATTTcctcataataataataataataataataataagccTCCGTTGAAGAA AAAGTATGGTGGAGTACCTAATTGCAACAATGGTGTTAAAATTAGTCCTATTTTGAATGTTCCTCCTCCTTATATAGCTA AAGGAGCTGCAAATCTGTTTGGTTTGGGATCTCTTTTGAGAAATggcaaagaaaagaacagaAAGTGAT
Gene structure

JCDB Genes gff download

JCDBG25285 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG25285's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG25285JCDBG18993co-exp0.766723
JCDBG25285JCDBG05420co-exp0.764348
JCDBG25285JCDBG10701co-exp0.755895
JCDBG25285JCDBG23696co-exp0.74866
JCDBG25285JCDBG17660co-exp0.747996
JCDBG25285JCDBG08689co-exp0.744581
JCDBG25285JCDBG05967co-exp0.744564
JCDBG25285JCDBG22600co-exp0.739893
JCDBG25285JCDBG07050co-exp0.739575
JCDBG25285JCDBG00190co-exp0.735092
JCDBG18993JCDBG05420co-exp0.80516
JCDBG18993JCDBG10701co-exp0.73025
JCDBG18993JCDBG23696co-exp0.743854
JCDBG18993JCDBG17660co-exp0.779677
JCDBG18993JCDBG08689co-exp0.762453
JCDBG18993JCDBG05967co-exp0.734408
JCDBG18993JCDBG22600co-exp0.782218
JCDBG18993JCDBG07050co-exp0.815086
JCDBG18993JCDBG00190co-exp0.778415
JCDBG05420JCDBG10701co-exp0.744583
JCDBG05420JCDBG23696co-exp0.759966
JCDBG05420JCDBG17660co-exp0.857822
JCDBG05420JCDBG08689co-exp0.714424
JCDBG05420JCDBG05967co-exp0.678442
JCDBG05420JCDBG22600co-exp0.631219
JCDBG05420JCDBG07050co-exp0.83894
JCDBG05420JCDBG00190co-exp0.744614
JCDBG10701JCDBG23696co-exp0.77574
JCDBG10701JCDBG17660co-exp0.801754
JCDBG10701JCDBG08689co-exp0.640445
JCDBG10701JCDBG05967co-exp0.80623
JCDBG10701JCDBG22600co-exp0.707971
JCDBG10701JCDBG07050co-exp0.807097
JCDBG23696JCDBG17660co-exp0.725457
JCDBG23696JCDBG08689co-exp0.734783
JCDBG23696JCDBG05967co-exp0.846707
JCDBG23696JCDBG22600co-exp0.633575
JCDBG23696JCDBG07050co-exp0.783885
JCDBG23696JCDBG00190co-exp0.68272
JCDBG17660JCDBG08689co-exp0.756395
JCDBG17660JCDBG05967co-exp0.710599
JCDBG17660JCDBG22600co-exp0.72752
JCDBG17660JCDBG07050co-exp0.90429
JCDBG17660JCDBG00190co-exp0.719871
JCDBG08689JCDBG05967co-exp0.672819
JCDBG08689JCDBG22600co-exp0.808108
JCDBG08689JCDBG07050co-exp0.797196
JCDBG08689JCDBG00190co-exp0.748268
JCDBG05967JCDBG22600co-exp0.671445
JCDBG05967JCDBG07050co-exp0.761866
JCDBG05967JCDBG00190co-exp0.615794
JCDBG22600JCDBG07050co-exp0.736509
JCDBG22600JCDBG00190co-exp0.745256
JCDBG07050JCDBG00190co-exp0.733462
PPI network
node1node2type
JCDBR33773
ID
JCDBR33773
Name
XM_012237667.1
Type
Scaffold
NW_012130064.1
Start
852595
End
853383
Strand
+
Exon
852595-853383
Sequence
TGTGTTCAGAAACAAGCCCTCGTATATCATTCTCTAATGATCTTGCTCATGGCGATGGCACAGAAAACGAGCACGTGCCT AGAAGAGACACAACGCTCCTTGAATCAAATTCCGACTTCGAATTCAACATCTCCAGTCGTCTGCTAGATTATGAATCTTC TTTGGCAGATGAGCTTTTCTCCAATGGCATGTTACTTCCTTTCCAAGATAATAAACAAGAAACTTCTCCAAACGTTTCTC AAAATATTTCACGAAACGTTTCACGACATGTTTCTCTCCTTCctcttccttctccttcttgtTCCACTCTTACCAGTTCT TCAAattcaagaaagaaattgaGTAATACTGAAATTAGGGTTTCGAATTCGGAATTGGAAGAAAAGGCAGAgccaaaatc aacattttggGGATTCAAGAGAAGTAATAGTCTAAACTGTGATCTAAAGAAAGGTTCAATTTTTTCATTGCCAGTTTTGT CAAGAAGCAATTCAACTGGAACAGCAGCGCCAAATTCAAAGAGATCATCAATGGCAAAGAAGTTATTACCATCAACATCT TCTGGTTCTTCTACTAATTATGTGTACACATTTcctcataataataataataataataataataagccTCCGTTGAAGAA AAAGTATGGTGGAGTACCTAATTGCAACAATGGTGTTAAAATTAGTCCTATTTTGAATGTTCCTCCTCCTTATATAGCTA AAGGAGCTGCAAATCTGTTTGGTTTGGGATCTCTTTTGAGAAATggcaaagaaaagaacagaAAGTGAT
Product
probable myosin light chain kinase DDB_G0279831
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237667.1
JCDBP29704
ID
JCDBP29704
Parent
JCDBR33773
Name
XP_012093057.1
Scaffold
NW_012130064.1
CDS
852595-853383
Strand:
+
Sequence
MCSETSPRISFSNDLAHGDGTENEHVPRRDTTLLESNSDFEFNISSRLLDYESSLADELFSNGMLLPFQDNKQETSPNVS QNISRNVSRHVSLLPLPSPSCSTLTSSSNSRKKLSNTEIRVSNSELEEKAEPKSTFWGFKRSNSLNCDLKKGSIFSLPVL SRSNSTGTAAPNSKRSSMAKKLLPSTSSGSSTNYVYTFPHNNNNNNNNKPPLKKKYGGVPNCNNGVKISPILNVPPPYIA KGAANLFGLGSLLRNGKEKNRK
Product
probable myosin light chain kinase DDB_G0279831
Source
Gnomon
Link
XP_012093057.1
InterProScan
Pfam