Detail information of JCDBG25286

JCDBG25286
ID
JCDBG25286
Name
LOC105650695
Type
protein_coding
Scaffold
NW_012130064.1
Start
860058
End
861509
Strand
-
Link
Genbank id:105650695
Molecular function
Cellular component
Biological process
KEGG
K16276
Source
Gnomon
TF
Description
hypothetical
Sequence
TaaaggaaatatataaatataaatataaatttcccGGCGATTATGATCATCGCATTACAACCCAAAAGCCAAAATTCCTT CTCTGTTTCTCAATCTGAGCAAAATCTTCCATACATTCTCAAAATCTAACCTCCATTGAAACAAACCCAaccataaaaat caaaattttacatgATTATCAAATAGAGAAGCTACACAAATAGAGGACTCTACACACAGACAACAATGGCGATGCCACCT CCTACGCCTCAACAACAACCACAGCAACAAGAGAGATCAAAGCCACTACACAACTTCTCTTTGCCTTTCTTGAAATGGGG ACAACAAAGAGTCCTTAGGTGTGTCAAAGTCAGTGATGATCATcgatcttcttcttcttcgatTCCAAATGGATTTGGAT TTCAATCCAAACCCACCAATTTTGACTCTTCGAACAATCACAACCCTAATTTAATTCAACAAAATCACATTTCATCTGAT CTTAGACTCAATGGAGGTGCTGCTGCTAAAAGATTGAAGGTTTCTCCTCTTCTTGAAGAAGAGAGACCACCTCCTAATAT TAATGATgatgctgctgctgctgctgctcgGCCTTGGAATTTGAGAACCAGAAGGGCTGCGTGTAAGGCGCCACTGCGAA TAGAAGACAAGAGGAATTTGGAGTCTCCGAAGAGAATTTTGGAGATTGATTCGCCAAATAGAATTGAGACTTCTTTGGTT AAGAGGCAGAGTGTTGAGCCTGTTAAAGAGAGAATCAAGTTTTCTGTTCCTTTATCAAAGACAGAGATTGAGCAGGATTT CATGGAGATTGCAAGGATTAGGCCTCCTAGGAGGCCTAAGAAGAGGCCTCGAATTGTGCAGAAGTATTTGGACGTAAGGA CTTCTggttttcttctcttttcttttcttttttccatctttaatatttttttttttaatatttgctgGGAACATGTGGGA AAGTAGAGGAagttttggattttgattatttgaagtttTGCTATTTGGGGAGTGGTTTATTTAATTCAGTTTTTGGAGCT TTAGAGGTTGAATTAAAATTGCatgtaatatttaaagttgtttcctttttctccttATCTTAGTAACTAAATCTTGATTG ctatttctatttatatgttttataatttgtattaaGAATGTTTggtgtttatattttgttctttGGTTGTTTGCAGTCAA TTTTCCCAGGATTGTGGCTAGCAGAAGTTACGCCAGATTCATATAAGGTTCCTGAAGTACCTGAGTCATGAGAGGTGATA ATCtctaatttcatatttatgttctttttttttttttttctcattgatTAGATGGGTTATTTGGATTCTTACATATAGAA TTCAATCTTGTTGTTGCAGAGGCAGAAATGAAAGTGTAATTGTTTTCAGGGGAATTCCTTATATTCTGCTTGCTAACAAT GGTGCATTTGAC
Gene structure

JCDB Genes gff download

JCDBG25286 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG25286's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG25286JCDBG03410co-exp0.86842
JCDBG25286JCDBG12208co-exp0.864522
JCDBG25286JCDBG02933co-exp0.863299
JCDBG25286JCDBG24466co-exp0.848934
JCDBG25286JCDBG15465co-exp0.843292
JCDBG25286JCDBG20744co-exp0.842782
JCDBG25286JCDBG16033co-exp0.841589
JCDBG25286JCDBG12407co-exp0.841294
JCDBG25286JCDBG20724co-exp0.840492
JCDBG25286JCDBG07670co-exp0.840298
JCDBG03410JCDBG12208co-exp0.915779
JCDBG03410JCDBG02933co-exp0.907903
JCDBG03410JCDBG24466co-exp0.850898
JCDBG03410JCDBG15465co-exp0.849411
JCDBG03410JCDBG20744co-exp0.872102
JCDBG03410JCDBG16033co-exp0.914471
JCDBG03410JCDBG12407co-exp0.829027
JCDBG03410JCDBG20724co-exp0.872463
JCDBG03410JCDBG07670co-exp0.859187
JCDBG12208JCDBG02933co-exp0.923292
JCDBG12208JCDBG24466co-exp0.821253
JCDBG12208JCDBG15465co-exp0.834081
JCDBG12208JCDBG20744co-exp0.857549
JCDBG12208JCDBG16033co-exp0.960039
JCDBG12208JCDBG12407co-exp0.819144
JCDBG12208JCDBG20724co-exp0.914811
JCDBG12208JCDBG07670co-exp0.83527
JCDBG02933JCDBG24466co-exp0.858047
JCDBG02933JCDBG15465co-exp0.836576
JCDBG02933JCDBG20744co-exp0.86816
JCDBG02933JCDBG16033co-exp0.906704
JCDBG02933JCDBG12407co-exp0.80056
JCDBG02933JCDBG20724co-exp0.890893
JCDBG02933JCDBG07670co-exp0.853579
JCDBG24466JCDBG15465co-exp0.838651
JCDBG24466JCDBG20744co-exp0.906277
JCDBG24466JCDBG16033co-exp0.7908
JCDBG24466JCDBG12407co-exp0.797187
JCDBG24466JCDBG20724co-exp0.832894
JCDBG24466JCDBG07670co-exp0.871627
JCDBG15465JCDBG20744co-exp0.8531
JCDBG15465JCDBG16033co-exp0.850665
JCDBG15465JCDBG12407co-exp0.852746
JCDBG15465JCDBG20724co-exp0.789963
JCDBG15465JCDBG07670co-exp0.85523
JCDBG20744JCDBG16033co-exp0.842173
JCDBG20744JCDBG12407co-exp0.801196
JCDBG20744JCDBG20724co-exp0.813599
JCDBG20744JCDBG07670co-exp0.873155
JCDBG16033JCDBG12407co-exp0.806694
JCDBG16033JCDBG20724co-exp0.884934
JCDBG16033JCDBG07670co-exp0.813639
JCDBG12407JCDBG20724co-exp0.768226
JCDBG12407JCDBG07670co-exp0.769091
JCDBG20724JCDBG07670co-exp0.774719
PPI network
node1node2type
JCDBR33774
ID
JCDBR33774
Name
XM_012237639.1
Type
Scaffold
NW_012130064.1
Start
860058
End
861509
Strand
-
Exon
860058-860131,860237-860314,860638-861509
Sequence
TaaaggaaatatataaatataaatataaatttcccGGCGATTATGATCATCGCATTACAACCCAAAAGCCAAAATTCCTT CTCTGTTTCTCAATCTGAGCAAAATCTTCCATACATTCTCAAAATCTAACCTCCATTGAAACAAACCCAaccataaaaat caaaattttacatgATTATCAAATAGAGAAGCTACACAAATAGAGGACTCTACACACAGACAACAATGGCGATGCCACCT CCTACGCCTCAACAACAACCACAGCAACAAGAGAGATCAAAGCCACTACACAACTTCTCTTTGCCTTTCTTGAAATGGGG ACAACAAAGAGTCCTTAGGTGTGTCAAAGTCAGTGATGATCATcgatcttcttcttcttcgatTCCAAATGGATTTGGAT TTCAATCCAAACCCACCAATTTTGACTCTTCGAACAATCACAACCCTAATTTAATTCAACAAAATCACATTTCATCTGAT CTTAGACTCAATGGAGGTGCTGCTGCTAAAAGATTGAAGGTTTCTCCTCTTCTTGAAGAAGAGAGACCACCTCCTAATAT TAATGATgatgctgctgctgctgctgctcgGCCTTGGAATTTGAGAACCAGAAGGGCTGCGTGTAAGGCGCCACTGCGAA TAGAAGACAAGAGGAATTTGGAGTCTCCGAAGAGAATTTTGGAGATTGATTCGCCAAATAGAATTGAGACTTCTTTGGTT AAGAGGCAGAGTGTTGAGCCTGTTAAAGAGAGAATCAAGTTTTCTGTTCCTTTATCAAAGACAGAGATTGAGCAGGATTT CATGGAGATTGCAAGGATTAGGCCTCCTAGGAGGCCTAAGAAGAGGCCTCGAATTGTGCAGAAGTATTTGGACGTAAGGA CTTCTggttttcttctcttttcttttcttttttccatctttaatatttttttttttaatatttgctgGGAACATGTGGGA AAGTAGAGGAagttttggattttgattatttgaagtttTGCTATTTGGGGAGTGGTTTATTTAATTCAGTTTTTGGAGCT TTAGAGGTTGAATTAAAATTGCatgtaatatttaaagttgtttcctttttctccttATCTTAGTAACTAAATCTTGATTG ctatttctatttatatgttttataatttgtattaaGAATGTTTggtgtttatattttgttctttGGTTGTTTGCAGTCAA TTTTCCCAGGATTGTGGCTAGCAGAAGTTACGCCAGATTCATATAAGGTTCCTGAAGTACCTGAGTCATGAGAGGTGATA ATCtctaatttcatatttatgttctttttttttttttttctcattgatTAGATGGGTTATTTGGATTCTTACATATAGAA TTCAATCTTGTTGTTGCAGAGGCAGAAATGAAAGTGTAATTGTTTTCAGGGGAATTCCTTATATTCTGCTTGCTAACAAT GGTGCATTTGAC
Product
uncharacterized LOC105650695
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237639.1
JCDBP29705
ID
JCDBP29705
Parent
JCDBR33774
Name
XP_012093029.1
Scaffold
NW_012130064.1
CDS
860240-860314,860638-861285
Strand:
-
Sequence
MAMPPPTPQQQPQQQERSKPLHNFSLPFLKWGQQRVLRCVKVSDDHRSSSSSIPNGFGFQSKPTNFDSSNNHNPNLIQQN HISSDLRLNGGAAAKRLKVSPLLEEERPPPNINDDAAAAAARPWNLRTRRAACKAPLRIEDKRNLESPKRILEIDSPNRI ETSLVKRQSVEPVKERIKFSVPLSKTEIEQDFMEIARIRPPRRPKKRPRIVQKYLDSIFPGLWLAEVTPDSYKVPEVPES
Product
uncharacterized protein LOC105650695
Source
Gnomon
Link
XP_012093029.1
InterProScan
IPR012438 Protein of unknown function DUF1639
Pfam
PF07797.10 DUF1639 Family