Detail information of JCDBG25287

JCDBG25287
ID
JCDBG25287
Name
LOC105650696
Type
protein_coding
Scaffold
NW_012130064.1
Start
864308
End
874183
Strand
-
Link
Genbank id:105650696
Molecular function
GO:0005515 | protein binding
GO:0008270 | zinc ion binding
Cellular component
Biological process
KEGG
Entry: K16276
Name: K16276, BTS
Definition: zinc finger protein-like protein
Source
Gnomon
TF
Description
zinc
Sequence
ccaaaaacttaaaaaaacacaaaccAACCTCCCTCTCCGTTGAACAAAACTGAAATATAtcctttaaaattaaaatccga AATAAATTTCTGTCTCAGAGAAGGGAAGACTTTTGACGATACAATTCAggtcaaaaacaaaaagctagatagagaaagag aaatgGCCACGCCGTTACCGGAATTGCAGAGAGGGGAAGGTATGATACTGTCAAGCGCGGTCAAGAACGTTGAGGCGAAA GGTTGTTTAGAGAGTAACGAGCAGAAATCACCGATTCTGATATTCCTTTACTTCCACAAGGCTATACGTAATGAGCTTGA TTCGCTTCACCGACTAGCCATGGCTTTTGCTACTGGACAGACTGTTGATGTTGAGTCTCTCTTCGAACGATACCGGTTTC TCAGATTGATTTATAAGCACCACTGCAATGCCGAAGACGAGGTGCCTATTTAAAATTCTGCTTTTTCTCTGTCCTTTTTG GCTCGTTTTAGCTATTCAGTGGCATGTTTGATGATGTATTGAGATGTTAACACGtaattttgaagaattttagGTTCGGA GTCGAATTATTAGAACAGTTGCTAGAATTTtagagaaataattaattatttcagttTTCGCTTTTAATTCTACACATACG GTCAACTGCTTTGTGAATTGTCAAGAGGAAGGGatgataattttcttttgaaaacaaactgttgtgtatttttttttttt tttttttgacattgttATTAGGCTTAAGTAGTTGTTTTTGGGACCCACACCGTTTGGTACTTTTGCTGCGAGTccaaaag tttcaaaaattgtGTGGGATATACTAAATCTAAAAACTTTGAAATCTTTGAATCAGATAGGAAGTGCttgtaatattttg ttaagCTTGGGAAATTATCCCATATCTAGTTTGTTTCTGGTGGGAATGGTAATCGTTTTCTTGTTGAGGCGATTCACTTT TGGAAGTTCTCTGTTTGAAGTTTTCTACTGTGCTTGCTTTTGTGTTgtttatagataattaataacCTGTTAGGAAACTA GTTCTAGCAGTTAAACAAAATGTTTCCAATCTCATTATTTTACGTTCAactaattattagaaaatgcaaaacatcttaaa attttgtttagtgATAATATGCTTATGTAAAATGGTTATTTTGTTAAGCATTTGTatcatgtttttttaatagaaaagat aCGAGTTATGTtgtttgtaaaatataaaatatgaaatttattttttgggatttaacattgcaataatatttaaaatccgG TGCACGAAACTTACCATTTTGCATCTAATGGATCTATGTTATTTCCATCTTGACCCTCGGGAAGTAactgaaactttttt ttttcatccatATATTCTGCCATACCTGATGGCACAATATTTTGGAAATGCAGGTTATTTTTCCAGCTCTTGACATACGT GTGAAGAATGTGGCACAAACATACTCACTTGAACACAAAGGTGAAAGCAGTCTGTTCGATCAATTATTTGAGCTGCTAAA TTCTTATACGCAAGATGATGAAAGTTTCCCAAGGGAATTAGCATCTTGCACAGGTGCCCTTCAGACGTCACTCAGTCAGC ACATGGCAAAGGAAGAGGAACAGGTAAGGTGTTATTagtattctttattttgtgtaTTACTTCAAGGAACTCCTCATAAT ATTTTCGTTTTCCACATGCATGTGCAATATCTCCTATAGGAAACTGGGATATGATACTACATGGATTGATGCAACTTGCa tgagatttttcttttttcttttttaaaaaaaaaattactaacaCAAATACAGAAGCAGGACAGAGTCTGAGTCTTGATAA TGTTGTTAAATGTGATTGTTTGGTCcttttcttatataattttccacatgttttctatttttttcaagtcCCTTTCTCCT CCCCACTGTCCTCTCCTTGCTACTCTCATTCGTTGGGATGCTTTGAGCATTATCTACTTATATGTTAGTTCAAAGTTGAA CAAGATTTTTTGTGGTCCTTGCGAAAGTAAGGAAAAAGTTGGTCAGTGTGGTTGCTTGATGATGATTCAatgtgaataaa attttaaagttgttATCTTTTCATAAGAATCAAATGTTAAAATTCTGTCCACAAGATTATTCATCCTGTCAGATGCCTGT GaatcaaaaagattttatgAGGCTAAAGTAGTTCCATTCCTACTGCACCAAATATGGGATGACTGTGTCAAAAGTGTAAT CTAAATACCCATTGGCGATAGGCTTCAAACTTCTGTTTTTAGTTGATTCATTAAACCATAATACAATGTTGTATAGAAGA GACAGTTGACCTTCACTCACTGTgggatattttcttttaaattgagAGCACAATTTTGTCAAGGATACAACATACCTGAA TAAAGGAACTGGAGATCTCTTCCTTCATAACAATAACAGCTTGGACAACAGCTTTTCAGGTTTGTTCTatggattaaatt aaaaaaaaaaaatgactgTACAATGTCCAGTGgatttttactgttttatttttttatttttgttcttcttctgAAATTTT TAGCTTACTTTTTCCGTTAGGCAGGCCTTGCTTGCATAATCTGTTGGGAAGCAAAATGATAAAGAGTAGGATATGACTTT TGATTTAATACCCACTAAAataattgtcaaaatttgagtagAAACTTTAGCACTATATAATTTGACCTAAATTCATGGAG TTTTTGTGCTCTAGATTCACTTCAATAACCCtttaaaacagaaaacaaTGTCGACTAGCTGTAGTTGTACCCAGACACAG TACAGTGGCAATCCACCTCTGTGGCACTGGCACTGCAACTATGGCCTTCTGGAATGAAATCCAAGGCTATGAGTGCAAAG GACAAAAAAGAGAAGACGAAATTGGATATATGGATAGGAAAATACATCTAATACTTATATCAAACAATTTCTCATTATGT GCATTTCCTGTTTATCAGGAACTCCTGGTGCGTCATCCTTTGTATTGTGCTACACTGTTGTCATCGTGACGATCTATGTG ATGCTTATGGTGATTTTCTGCTTGGCAAAATCTGAATCTAAGCCCTCTCTGTTCcttgattatttgaaaagaGTGGTGCC ACTGGTTGATGTAACTTATACATTTTCTCCTTGACCTATAATTTATCAATCGGAAAAAAATGCCatctagtaatagtaaa gcatcATCATAGTGGTCGGATGGGTCTGTTTATGCATTTTCACCACAATTGTTCATGAATCATGGCAAATGCAGTAGTAT TGAATCCAAAATACTGGTAACGTTTGGAgtgttgattttgttttttctgaaaaacataaagattGTAATAggttttctct ttattatgTCAGGTCTTTCCTTTGCTTATTGAGAAGTTTTCTCTCGAAGAGCAGGCATCTCTAATCTGGCAGTTTGTTTG CAGCATTCCTGTGAACATTATGTCAGAACTCATGCCATGGTTAGCATCTTCTATTTCACCCATTGAATCCCAGGATATGC AGAAGTGCTTAAGCAAGATAATCCCAGAAGAGAAGCTTCTTCAGCAGGTAaaggatttatttttcatttagcATTTATTT CTTCTTGGGTTATTTTGCTGAATGTTCATAGCTGATCAAAAGCGTTTTTCTTGGGAAGGTTGTCTTTACCTGGATAAGAG GGAGAAATGGTGCGAAGGAAGTTGGAAGCTGCACAGATAATCATCAGGATCAATATTGTGTAAATTATACTATTAGTGCA ATGAATTCTGAATTGGGTGATGTGATGGGTACATGTGACGAACATAAAATTGGGAAAAGGAAATATCTGGAATCAAGTAA TGATGCTTCAGATACTACTGGAACACACCCGATAAACGAAATAATGCTTTGGCATAATGCTATTAAACAAGAATTGAATG AAATCGCTGAAGAAGCTAGAAAGATTCAACTTTCTGGagattttatgaatttatcaGCCTTTGATGATCGGTTGCAATTC ATTGCTGAAGTTTGCATCTTCCACAGGTGTGTCCTTTCTGTTGTTAGACTTTGCAAATAGATATTTACTCTTCATTTTTC ACAGAATTACTTGGTTTAGCCTTTTCTCGTTTTATGAAGTAGTCTTTCATggtatttttcatatttgtgaGATGCTTAGT TGTAAATGTGgagaaaaagatatatattgCCCTAAAAATTGTTTTGTCATCAATATGCAGAAGGAAGCTTATTCTTCTCT TAACATTGTTGAAGTGGCACATGCAGTTGTTACATGATGTAGACATTTACATTGTATTGATGCCCATAATTTTTTCcacc tttatttatttgtgtttttcttaTGTTTGTTTCTTCAATGACGGTGTTGAGTATTGTGGAGAAGATTCAATGATTTGGTA CCTTAATAGATAAACTGATCAAAGGTGGAAGGAAATAATTGACTGTTCTTTTCCATGGGCTTTGTTTGGGACAAAAGTTT ATGTTGCCATCCAGCATTGCTAATTATACAGTGCATGGAGCAGTCTGTAAGATATCCAATCTGAAAGATTTGTGTTTTCT TGGCTACAGTATCGCTGAGGACAAAGTCATATTTCCTGCAGTAGATGGAgaattctctttctttcaagAGCATGCAGAAG AAGAAAGTCAATTTGATGAGATTAGGCGTTTGATTGAAAGTATTCAAAGGGCAGGTGCAAATTCTAATTCAGCAGCTGAG TTTTATGCAAAATTATGCTCCCAAGCTGATCAAATAATAGATACCATACAAAGACACTTCTATAATGAGGAAATACAGGT GAGCGTTCCTTAGTTATGTGATAAATCCTGCTGGGGATGTTTGGTAGTCCGAAGAATGTGAAATTATgcctaatttaatt taatagtgAACAAGTACAACTTTGCTTGTCTGCtccaatttcaaatgtaaaGCTGGTTATAGAAACTATACATTCTTCTC GAAGGAGTTTAATATATGTGACATGACTAGATTCCTTGCATGTTTAGGTTCTTCCACTAGCTCGAAAGCACTTTAGCTTC AAGAGGCAGCAGGAACTTTTATACCAAAGCTTGTGTGTGATGCCTTTGAAATTGATTGAGCGTGTCTTGCCATGGTTGGT GGGGTTTCTAACTGAAGATGaagcaaaaaattttctcataAACATGCAGTCAGCAGGTTTTGTACTGTATAGCTACTTCT TATGagattaattctatttaatgAAGTCATATGGTTATATGTCTCTGCTCACATTTTTGATTATTCTGATTCAGCTCCAT TGACGGATACTGCTTTGATTACACTTTTTACTGGCTGGGCTTGCAAGGGTCGTAGCCGGGGTGCATGTTTGTCGAGTGCA ATTGGTTGTTTTTCTGCTAAAAACTTCACTGATATTGAAGAAGATATTGTTAGATCATGCTGTGCATGTACTTCTGCATT TTGTTCTAAGGATTGCGTTGTATCAGTTTGTGAAGATGACAACAAAAGGCCCGTCAAAAGAAACATTCCGTTATCATGCA AAAATAGCAATGCCCCGGACCTCTCAAGAACTCTAAGTTCCCATACACCATCTTGTGCCGATCGATCTTGTTGTGTACCA GGTTTAGGAGTGAACAGCAACAACCTTGGTTTGAATTCTCTTTCAACTGCCAAATCTTTGCGGTCCTTGTCTTTCAGCTC CTCTGCTCCAGCTCTTAACTCCAGTCTTTTTTCTTGGGAAGCGGATAATAGCTCCTTTGATATTGGCCGTGCAGAACGAC CAATTGATACAATATTTAAGTTTCATAAAGCCATAAGCAAAGATTTGGAGTATCTAGATGTGGAATCTGGAAAGCTCAGT GATTGTGATGAGACAATTCTTCAGCAGTTTGTTGGAAGATTCCGTTTATTATGGGGCTTATACAGGGCTCATAGTAATGC TGAGGATGATATTGTTTTTCCAGCTCTGGAGTCCAAAGAGGCACTTCATAATGTGAGTCATTCATACACACTGGACCATA AGCAGgaggaaaaattatttgaagatATTTCATATGTTCTTTCTGAGCTTTCCAGCCTTCATGAAATCTTGCAAAAAGCC CGCATGATGGAGGATTCAGTGAGAAGCAATGTGGAACTTTCTGTTGCCCATGACGGTATTGATGATTGTGTGGCAAAGTA TGGTGAGCTAGCCACTAAGCTGCAAGGGATGTGCAAATCTATAAGAGTTACTCTTGATCACCATATTTTGAGAGAAGAAG TTGAGTTATGGCCATTGTTTGGAAAGCATTTTTCGGTTCAGGAGCAAGACAAAATAGTTGGCCGCATTATTGGCACTACT GGTGCTGAAGTTCTGCAATCTATGTTACCTTGGGTAACTTCTGCTCTTACTCAGGACGAGCAGAACAAAATGATGGATAC ATGGAAGCAGGCAACCAAAAACACAATGTTCAGCGAGTGGCTTAATGAATGCTGGAAAGGACCTGCAGAATTATCTTTGC AGGCTGAAACATCAGAAGCTAGGATTCCTAGAGAAGGTTTGTTCAATGTCTCTAGTTTTTGTGTTGCTAGCATCCTTGTG CAGTGTCATGCAGCATTGGATAGTTTTATGAAGGTCATTTACCTAGAAATGCAAATTTTCTACTCAGTTCAGCCTTGCTT GTTGCAGACAAAGAGTTTCAAGAGAGCTTGGAGCAAAGTGATCAGATGTTTAAGCCTGGGTGGAAGGATATCTTCCGCAT GAATCAAAATGAGCTTGAATCTGAGATTAGAAAGGTTTACAAGGATGCAACTCTTGATCCAAGGAGAAAATCATATCTTG TTCAAAATCTTTTGACTAGGTTAGTTCTGATAACTGTAATAtgctttttccctttttatctttattcCCTTCAAAAAATT AGTGAAATGCATTGATGTTAGCTGTCGTtatattttgttgttgttgttgttgttgttgtttgtCCTAAATTAACCTTTAA GTAGCTGGTTTGTTTTAGTCGCTGGATAGCTGCGCAGCAGAAGTTACCTCAAGGAATCTCAGGTGAAACCTCTAATGGTG GTGACATAATGGGATGTTCACCATCATTTCGAGATCAGGAAAAGCAGATATTTGGGTGTGAGCACTACAAGCGGAACTGT AAACTTCGTGCTGCTTGTTGTGGCAAATTGTTTACTTGTAGATTTTGCCATGACAAAGTAAGCGATCACTCGATGGATAG GTaatgtttgaaattattgattaaatttcatattttgactGAAGCTTCTGAATGCATGATGTTTTGCTGATCCACTGCAG AAAAGCAACCTCAGAAATGATGTGCATGCGTTGTCTGAAGATTCAGGCAGTTGGCCCGATCTGCACGACACCTGCGTGTA ATGGACTTCTGATGGCAAAATATTATTGCAATATATGCAAGTTTTTTGATGATGAAAGGTACAGTTCAATTTTGACTAAC AACTGGTTTTACACACTGTGAACTTGATTTTGCTCTTATTATGAATGCATACAGACATTTTTCTTAACATTTGTGCATGG CCACTTCAGGAGAGTATATCATTGCCCTTTTTGCAATTTATGTCGTGTTGGGAAGGGTCTTGGGATTGATTACTTCCATT GCATGACATGCAACTGTTGCTTGGGGATTAAGTTGGTGAATCACAAGTGTCTGGAAAAAGGTTTAGAGACAAACTGTCCC ATCTGCTGTGATTTTTTGTTCACATCAAGTGCAACTGTCAGAGCTTTGCCTTGTGGCCATTACATGCATTCAGCTTGCTT TCAGGTTTCTGTCTCTTAAACCTTCCACTTCCAGTCTGTCtcttttactttatttctTAACTTCCCTTGGATGCGTCAGA CTGGTTGAAATTTCTCACACCACGTTTTCTTTAATAGGCATACACTTGCAGTCACTACATCTGCCCAATATGCAGTAAAT CATTAGGAGATATGGCGGTAAGAAAACCTTctgttactattttttttttatttgcaagtTTCCCATGGATACCTATAACA TTGACGAGCCAGATTAAAATTGGATATGATGTTCTCCTATTTggttttgttgaatttaaaagaGTAAGTTGGTAAAGATA CCAGCAGCCCTTGATTAAATTGTCTGCTGTCTTATTTTTGTCAGTTTGCTTGGCTGCATATTCATGAGGTAAGAGGTATT ATTTTGTCCTTATTGTTATTTGTTAATCAACTCAGGTTTACTTTGGCATGCTTGATGCATTGCTGGCTGCTGAGGAGCTT CCAGAGGACTATAGGGATCATTGTCAGGTAATATTATTGTCTCTTGTAATTAGTTCTCAAGTGAAAGTGAAAATACTGTG TGCTTATTTCTGCTGAAATAATCACATGAAGAGGGAGTTTAGTTCGATTGGTTCTTTGCCACTAAGATGCACTCGATACC AAGGTTAAtgaattacaaatttttactGACCCATAAAAGAAGCAAAttgtggaaaaataaaataagtgaaGGAAATGAAG GATAGTGAGTTTCGTAGGCTTTGTTTATTAGAACTTTCCATTCATTGCTTGGTAAGCTCTCAATTTAAACTTAGCCCAAT AGGGGGTGTAAATGAGACGTTTAGCTGGTGATCCTACAATATGGTAGGCCAATTTTTTGAAGGCCTAAGCTTGCGTATAT GCTTTAAATGAGTTGATGAACTATAATTTAACCAAACTCATTCATGTTTCAGCTTTTGGTTATTTCTTAAGCAAGCCTAA CACTTTGCTTAGAGGTTATCGATCAATACTCTTAAAACTTAAGATGATTGAGTTTCCAGCAAAGTTCTTGTCtgctataa aaatatagagagGAGATGGGCGGATATTTGTTCTGAAGTCTTTCCCACATGCATTTCCATGCATCCCCTTTTTAGATTAG TCTAATTAGAGTTTGAAAACCAATTTTGTTGATTGCCATTTTCACATTTGCCCTTTGGAATGACTGAGCGAGAAGGCAAG AGGCAAAAGAGAAAGTTATGCATTTAGGGTGAAATTGAACCCTATGTCAGAACTGCATAGTTTTGATATTGGTTTACTTA AACTTGGCTTGTAAGCTGGAGCTAAGCTCGAACTCGGCTCGTCTGTTAAAAGAGCTCAATAaaaaaagcttgagctcaaC TTGTTGGCCCGACTCATTTACAGCCCTACTGAAATGCACTCACTGCACATTCACATCATGTGGTCCGTTGTATACAAGCT TGAGCTCGGCTCGTTTGTTAAAAGAGCTCAATaaaaaagcttgagctcaaCTTGTTGGCCTGACTCATTTACAGCCCTAC TGAAATGCACTCACTGCACATTCACATCATGTGGTCCGTTGTATACAAGAAATGTTGAAGCCAGTATAATTATTGAATGG TATTATCAATAGTGCAAACTTCTAATCCAGATGATTACACTTAGGTATCAAATGAGTCTAATATTCATCTAAATAATGCA GGATATATTATGTAATGATTGTGATCGAAAGGGCACTGCACGTTTCCACTGGTTATATCACAAGTGTGGAGTTTGTGGTT CGTACAACACTCGGGTGATCAAGAGTGAGACAGTAAAGCCCAACTCTGCTCCACCTTAATGAGACTCACATTTTGATGAG TTATAGGTATTAGGCTGTATATACTTTGTCAATCCGATCAATTTTCCCTCTTGAAGGAGAGGTGATTTCTTgtcattttt tgtttcttgcacCAAAAATTCATCACCCTTATAGAAACTCTTTAGGATGATTTTCTCTTGCTTGAGTTCCTCAGTTGGTG TAGATGAGCAAAATTAGGAGATCTTTTGGTTCTGATTTACTTCATTATGTATAGAATAGAAAATGTTCTGTGTAAAGTAC GTCTTTTCATGTCGAAGAGGACCCGGCTTATGAACT
Gene structure

JCDB Genes gff download

JCDBG25287 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG25287's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG25287JCDBG12585co-exp0.807364
JCDBG25287JCDBG02331co-exp-0.779157
JCDBG25287JCDBG21350co-exp-0.763255
JCDBG25287JCDBG13917co-exp0.759562
JCDBG25287JCDBG03711co-exp0.75348
JCDBG25287JCDBG06551co-exp0.751874
JCDBG25287JCDBG01780co-exp-0.7388
JCDBG25287JCDBG16833co-exp0.737525
JCDBG25287JCDBG24343co-exp-0.733081
JCDBG25287JCDBG14221co-exp0.720752
JCDBG12585JCDBG02331co-exp-0.7148
JCDBG12585JCDBG21350co-exp-0.624455
JCDBG12585JCDBG13917co-exp0.883598
JCDBG12585JCDBG03711co-exp0.816694
JCDBG12585JCDBG06551co-exp0.702151
JCDBG12585JCDBG01780co-exp-0.774391
JCDBG12585JCDBG16833co-exp0.679601
JCDBG12585JCDBG24343co-exp-0.779596
JCDBG12585JCDBG14221co-exp0.663204
JCDBG02331JCDBG21350co-exp0.786091
JCDBG02331JCDBG13917co-exp-0.647257
JCDBG02331JCDBG03711co-exp-0.668343
JCDBG02331JCDBG01780co-exp0.788545
JCDBG02331JCDBG24343co-exp0.732571
JCDBG02331JCDBG14221co-exp-0.660784
JCDBG21350JCDBG13917co-exp-0.626851
JCDBG21350JCDBG06551co-exp-0.666349
JCDBG21350JCDBG14221co-exp-0.659545
JCDBG13917JCDBG03711co-exp0.721928
JCDBG13917JCDBG06551co-exp0.722073
JCDBG13917JCDBG01780co-exp-0.716297
JCDBG13917JCDBG16833co-exp0.650065
JCDBG13917JCDBG24343co-exp-0.72153
JCDBG13917JCDBG14221co-exp0.676337
JCDBG03711JCDBG06551co-exp0.635605
JCDBG03711JCDBG01780co-exp-0.643673
JCDBG03711JCDBG16833co-exp0.649093
JCDBG03711JCDBG24343co-exp-0.672021
JCDBG03711JCDBG14221co-exp0.602013
JCDBG06551JCDBG16833co-exp0.611013
JCDBG06551JCDBG14221co-exp0.656588
JCDBG01780JCDBG24343co-exp0.840753
JCDBG16833JCDBG14221co-exp0.605244
PPI network
node1node2type
JCDBG25287JCDBG13290PPI
JCDBR33775
ID
JCDBR33775
Name
XM_012237640.1
Type
Scaffold
NW_012130064.1
Start
864308
End
874183
Strand
-
Exon
864308-864743,865918-865989,866248-866307,866421-866655,866767-866904,866985-867206,867366-867537,867669-868910,869009-869177,869387-869615,870159-870526,870618-870812,872562-872771,873744-874183
Sequence
ccaaaaacttaaaaaaacacaaaccAACCTCCCTCTCCGTTGAACAAAACTGAAATATAtcctttaaaattaaaatccga AATAAATTTCTGTCTCAGAGAAGGGAAGACTTTTGACGATACAATTCAggtcaaaaacaaaaagctagatagagaaagag aaatgGCCACGCCGTTACCGGAATTGCAGAGAGGGGAAGGTATGATACTGTCAAGCGCGGTCAAGAACGTTGAGGCGAAA GGTTGTTTAGAGAGTAACGAGCAGAAATCACCGATTCTGATATTCCTTTACTTCCACAAGGCTATACGTAATGAGCTTGA TTCGCTTCACCGACTAGCCATGGCTTTTGCTACTGGACAGACTGTTGATGTTGAGTCTCTCTTCGAACGATACCGGTTTC TCAGATTGATTTATAAGCACCACTGCAATGCCGAAGACGAGGTGCCTATTTAAAATTCTGCTTTTTCTCTGTCCTTTTTG GCTCGTTTTAGCTATTCAGTGGCATGTTTGATGATGTATTGAGATGTTAACACGtaattttgaagaattttagGTTCGGA GTCGAATTATTAGAACAGTTGCTAGAATTTtagagaaataattaattatttcagttTTCGCTTTTAATTCTACACATACG GTCAACTGCTTTGTGAATTGTCAAGAGGAAGGGatgataattttcttttgaaaacaaactgttgtgtatttttttttttt tttttttgacattgttATTAGGCTTAAGTAGTTGTTTTTGGGACCCACACCGTTTGGTACTTTTGCTGCGAGTccaaaag tttcaaaaattgtGTGGGATATACTAAATCTAAAAACTTTGAAATCTTTGAATCAGATAGGAAGTGCttgtaatattttg ttaagCTTGGGAAATTATCCCATATCTAGTTTGTTTCTGGTGGGAATGGTAATCGTTTTCTTGTTGAGGCGATTCACTTT TGGAAGTTCTCTGTTTGAAGTTTTCTACTGTGCTTGCTTTTGTGTTgtttatagataattaataacCTGTTAGGAAACTA GTTCTAGCAGTTAAACAAAATGTTTCCAATCTCATTATTTTACGTTCAactaattattagaaaatgcaaaacatcttaaa attttgtttagtgATAATATGCTTATGTAAAATGGTTATTTTGTTAAGCATTTGTatcatgtttttttaatagaaaagat aCGAGTTATGTtgtttgtaaaatataaaatatgaaatttattttttgggatttaacattgcaataatatttaaaatccgG TGCACGAAACTTACCATTTTGCATCTAATGGATCTATGTTATTTCCATCTTGACCCTCGGGAAGTAactgaaactttttt ttttcatccatATATTCTGCCATACCTGATGGCACAATATTTTGGAAATGCAGGTTATTTTTCCAGCTCTTGACATACGT GTGAAGAATGTGGCACAAACATACTCACTTGAACACAAAGGTGAAAGCAGTCTGTTCGATCAATTATTTGAGCTGCTAAA TTCTTATACGCAAGATGATGAAAGTTTCCCAAGGGAATTAGCATCTTGCACAGGTGCCCTTCAGACGTCACTCAGTCAGC ACATGGCAAAGGAAGAGGAACAGGTAAGGTGTTATTagtattctttattttgtgtaTTACTTCAAGGAACTCCTCATAAT ATTTTCGTTTTCCACATGCATGTGCAATATCTCCTATAGGAAACTGGGATATGATACTACATGGATTGATGCAACTTGCa tgagatttttcttttttcttttttaaaaaaaaaattactaacaCAAATACAGAAGCAGGACAGAGTCTGAGTCTTGATAA TGTTGTTAAATGTGATTGTTTGGTCcttttcttatataattttccacatgttttctatttttttcaagtcCCTTTCTCCT CCCCACTGTCCTCTCCTTGCTACTCTCATTCGTTGGGATGCTTTGAGCATTATCTACTTATATGTTAGTTCAAAGTTGAA CAAGATTTTTTGTGGTCCTTGCGAAAGTAAGGAAAAAGTTGGTCAGTGTGGTTGCTTGATGATGATTCAatgtgaataaa attttaaagttgttATCTTTTCATAAGAATCAAATGTTAAAATTCTGTCCACAAGATTATTCATCCTGTCAGATGCCTGT GaatcaaaaagattttatgAGGCTAAAGTAGTTCCATTCCTACTGCACCAAATATGGGATGACTGTGTCAAAAGTGTAAT CTAAATACCCATTGGCGATAGGCTTCAAACTTCTGTTTTTAGTTGATTCATTAAACCATAATACAATGTTGTATAGAAGA GACAGTTGACCTTCACTCACTGTgggatattttcttttaaattgagAGCACAATTTTGTCAAGGATACAACATACCTGAA TAAAGGAACTGGAGATCTCTTCCTTCATAACAATAACAGCTTGGACAACAGCTTTTCAGGTTTGTTCTatggattaaatt aaaaaaaaaaaatgactgTACAATGTCCAGTGgatttttactgttttatttttttatttttgttcttcttctgAAATTTT TAGCTTACTTTTTCCGTTAGGCAGGCCTTGCTTGCATAATCTGTTGGGAAGCAAAATGATAAAGAGTAGGATATGACTTT TGATTTAATACCCACTAAAataattgtcaaaatttgagtagAAACTTTAGCACTATATAATTTGACCTAAATTCATGGAG TTTTTGTGCTCTAGATTCACTTCAATAACCCtttaaaacagaaaacaaTGTCGACTAGCTGTAGTTGTACCCAGACACAG TACAGTGGCAATCCACCTCTGTGGCACTGGCACTGCAACTATGGCCTTCTGGAATGAAATCCAAGGCTATGAGTGCAAAG GACAAAAAAGAGAAGACGAAATTGGATATATGGATAGGAAAATACATCTAATACTTATATCAAACAATTTCTCATTATGT GCATTTCCTGTTTATCAGGAACTCCTGGTGCGTCATCCTTTGTATTGTGCTACACTGTTGTCATCGTGACGATCTATGTG ATGCTTATGGTGATTTTCTGCTTGGCAAAATCTGAATCTAAGCCCTCTCTGTTCcttgattatttgaaaagaGTGGTGCC ACTGGTTGATGTAACTTATACATTTTCTCCTTGACCTATAATTTATCAATCGGAAAAAAATGCCatctagtaatagtaaa gcatcATCATAGTGGTCGGATGGGTCTGTTTATGCATTTTCACCACAATTGTTCATGAATCATGGCAAATGCAGTAGTAT TGAATCCAAAATACTGGTAACGTTTGGAgtgttgattttgttttttctgaaaaacataaagattGTAATAggttttctct ttattatgTCAGGTCTTTCCTTTGCTTATTGAGAAGTTTTCTCTCGAAGAGCAGGCATCTCTAATCTGGCAGTTTGTTTG CAGCATTCCTGTGAACATTATGTCAGAACTCATGCCATGGTTAGCATCTTCTATTTCACCCATTGAATCCCAGGATATGC AGAAGTGCTTAAGCAAGATAATCCCAGAAGAGAAGCTTCTTCAGCAGGTAaaggatttatttttcatttagcATTTATTT CTTCTTGGGTTATTTTGCTGAATGTTCATAGCTGATCAAAAGCGTTTTTCTTGGGAAGGTTGTCTTTACCTGGATAAGAG GGAGAAATGGTGCGAAGGAAGTTGGAAGCTGCACAGATAATCATCAGGATCAATATTGTGTAAATTATACTATTAGTGCA ATGAATTCTGAATTGGGTGATGTGATGGGTACATGTGACGAACATAAAATTGGGAAAAGGAAATATCTGGAATCAAGTAA TGATGCTTCAGATACTACTGGAACACACCCGATAAACGAAATAATGCTTTGGCATAATGCTATTAAACAAGAATTGAATG AAATCGCTGAAGAAGCTAGAAAGATTCAACTTTCTGGagattttatgaatttatcaGCCTTTGATGATCGGTTGCAATTC ATTGCTGAAGTTTGCATCTTCCACAGGTGTGTCCTTTCTGTTGTTAGACTTTGCAAATAGATATTTACTCTTCATTTTTC ACAGAATTACTTGGTTTAGCCTTTTCTCGTTTTATGAAGTAGTCTTTCATggtatttttcatatttgtgaGATGCTTAGT TGTAAATGTGgagaaaaagatatatattgCCCTAAAAATTGTTTTGTCATCAATATGCAGAAGGAAGCTTATTCTTCTCT TAACATTGTTGAAGTGGCACATGCAGTTGTTACATGATGTAGACATTTACATTGTATTGATGCCCATAATTTTTTCcacc tttatttatttgtgtttttcttaTGTTTGTTTCTTCAATGACGGTGTTGAGTATTGTGGAGAAGATTCAATGATTTGGTA CCTTAATAGATAAACTGATCAAAGGTGGAAGGAAATAATTGACTGTTCTTTTCCATGGGCTTTGTTTGGGACAAAAGTTT ATGTTGCCATCCAGCATTGCTAATTATACAGTGCATGGAGCAGTCTGTAAGATATCCAATCTGAAAGATTTGTGTTTTCT TGGCTACAGTATCGCTGAGGACAAAGTCATATTTCCTGCAGTAGATGGAgaattctctttctttcaagAGCATGCAGAAG AAGAAAGTCAATTTGATGAGATTAGGCGTTTGATTGAAAGTATTCAAAGGGCAGGTGCAAATTCTAATTCAGCAGCTGAG TTTTATGCAAAATTATGCTCCCAAGCTGATCAAATAATAGATACCATACAAAGACACTTCTATAATGAGGAAATACAGGT GAGCGTTCCTTAGTTATGTGATAAATCCTGCTGGGGATGTTTGGTAGTCCGAAGAATGTGAAATTATgcctaatttaatt taatagtgAACAAGTACAACTTTGCTTGTCTGCtccaatttcaaatgtaaaGCTGGTTATAGAAACTATACATTCTTCTC GAAGGAGTTTAATATATGTGACATGACTAGATTCCTTGCATGTTTAGGTTCTTCCACTAGCTCGAAAGCACTTTAGCTTC AAGAGGCAGCAGGAACTTTTATACCAAAGCTTGTGTGTGATGCCTTTGAAATTGATTGAGCGTGTCTTGCCATGGTTGGT GGGGTTTCTAACTGAAGATGaagcaaaaaattttctcataAACATGCAGTCAGCAGGTTTTGTACTGTATAGCTACTTCT TATGagattaattctatttaatgAAGTCATATGGTTATATGTCTCTGCTCACATTTTTGATTATTCTGATTCAGCTCCAT TGACGGATACTGCTTTGATTACACTTTTTACTGGCTGGGCTTGCAAGGGTCGTAGCCGGGGTGCATGTTTGTCGAGTGCA ATTGGTTGTTTTTCTGCTAAAAACTTCACTGATATTGAAGAAGATATTGTTAGATCATGCTGTGCATGTACTTCTGCATT TTGTTCTAAGGATTGCGTTGTATCAGTTTGTGAAGATGACAACAAAAGGCCCGTCAAAAGAAACATTCCGTTATCATGCA AAAATAGCAATGCCCCGGACCTCTCAAGAACTCTAAGTTCCCATACACCATCTTGTGCCGATCGATCTTGTTGTGTACCA GGTTTAGGAGTGAACAGCAACAACCTTGGTTTGAATTCTCTTTCAACTGCCAAATCTTTGCGGTCCTTGTCTTTCAGCTC CTCTGCTCCAGCTCTTAACTCCAGTCTTTTTTCTTGGGAAGCGGATAATAGCTCCTTTGATATTGGCCGTGCAGAACGAC CAATTGATACAATATTTAAGTTTCATAAAGCCATAAGCAAAGATTTGGAGTATCTAGATGTGGAATCTGGAAAGCTCAGT GATTGTGATGAGACAATTCTTCAGCAGTTTGTTGGAAGATTCCGTTTATTATGGGGCTTATACAGGGCTCATAGTAATGC TGAGGATGATATTGTTTTTCCAGCTCTGGAGTCCAAAGAGGCACTTCATAATGTGAGTCATTCATACACACTGGACCATA AGCAGgaggaaaaattatttgaagatATTTCATATGTTCTTTCTGAGCTTTCCAGCCTTCATGAAATCTTGCAAAAAGCC CGCATGATGGAGGATTCAGTGAGAAGCAATGTGGAACTTTCTGTTGCCCATGACGGTATTGATGATTGTGTGGCAAAGTA TGGTGAGCTAGCCACTAAGCTGCAAGGGATGTGCAAATCTATAAGAGTTACTCTTGATCACCATATTTTGAGAGAAGAAG TTGAGTTATGGCCATTGTTTGGAAAGCATTTTTCGGTTCAGGAGCAAGACAAAATAGTTGGCCGCATTATTGGCACTACT GGTGCTGAAGTTCTGCAATCTATGTTACCTTGGGTAACTTCTGCTCTTACTCAGGACGAGCAGAACAAAATGATGGATAC ATGGAAGCAGGCAACCAAAAACACAATGTTCAGCGAGTGGCTTAATGAATGCTGGAAAGGACCTGCAGAATTATCTTTGC AGGCTGAAACATCAGAAGCTAGGATTCCTAGAGAAGGTTTGTTCAATGTCTCTAGTTTTTGTGTTGCTAGCATCCTTGTG CAGTGTCATGCAGCATTGGATAGTTTTATGAAGGTCATTTACCTAGAAATGCAAATTTTCTACTCAGTTCAGCCTTGCTT GTTGCAGACAAAGAGTTTCAAGAGAGCTTGGAGCAAAGTGATCAGATGTTTAAGCCTGGGTGGAAGGATATCTTCCGCAT GAATCAAAATGAGCTTGAATCTGAGATTAGAAAGGTTTACAAGGATGCAACTCTTGATCCAAGGAGAAAATCATATCTTG TTCAAAATCTTTTGACTAGGTTAGTTCTGATAACTGTAATAtgctttttccctttttatctttattcCCTTCAAAAAATT AGTGAAATGCATTGATGTTAGCTGTCGTtatattttgttgttgttgttgttgttgttgtttgtCCTAAATTAACCTTTAA GTAGCTGGTTTGTTTTAGTCGCTGGATAGCTGCGCAGCAGAAGTTACCTCAAGGAATCTCAGGTGAAACCTCTAATGGTG GTGACATAATGGGATGTTCACCATCATTTCGAGATCAGGAAAAGCAGATATTTGGGTGTGAGCACTACAAGCGGAACTGT AAACTTCGTGCTGCTTGTTGTGGCAAATTGTTTACTTGTAGATTTTGCCATGACAAAGTAAGCGATCACTCGATGGATAG GTaatgtttgaaattattgattaaatttcatattttgactGAAGCTTCTGAATGCATGATGTTTTGCTGATCCACTGCAG AAAAGCAACCTCAGAAATGATGTGCATGCGTTGTCTGAAGATTCAGGCAGTTGGCCCGATCTGCACGACACCTGCGTGTA ATGGACTTCTGATGGCAAAATATTATTGCAATATATGCAAGTTTTTTGATGATGAAAGGTACAGTTCAATTTTGACTAAC AACTGGTTTTACACACTGTGAACTTGATTTTGCTCTTATTATGAATGCATACAGACATTTTTCTTAACATTTGTGCATGG CCACTTCAGGAGAGTATATCATTGCCCTTTTTGCAATTTATGTCGTGTTGGGAAGGGTCTTGGGATTGATTACTTCCATT GCATGACATGCAACTGTTGCTTGGGGATTAAGTTGGTGAATCACAAGTGTCTGGAAAAAGGTTTAGAGACAAACTGTCCC ATCTGCTGTGATTTTTTGTTCACATCAAGTGCAACTGTCAGAGCTTTGCCTTGTGGCCATTACATGCATTCAGCTTGCTT TCAGGTTTCTGTCTCTTAAACCTTCCACTTCCAGTCTGTCtcttttactttatttctTAACTTCCCTTGGATGCGTCAGA CTGGTTGAAATTTCTCACACCACGTTTTCTTTAATAGGCATACACTTGCAGTCACTACATCTGCCCAATATGCAGTAAAT CATTAGGAGATATGGCGGTAAGAAAACCTTctgttactattttttttttatttgcaagtTTCCCATGGATACCTATAACA TTGACGAGCCAGATTAAAATTGGATATGATGTTCTCCTATTTggttttgttgaatttaaaagaGTAAGTTGGTAAAGATA CCAGCAGCCCTTGATTAAATTGTCTGCTGTCTTATTTTTGTCAGTTTGCTTGGCTGCATATTCATGAGGTAAGAGGTATT ATTTTGTCCTTATTGTTATTTGTTAATCAACTCAGGTTTACTTTGGCATGCTTGATGCATTGCTGGCTGCTGAGGAGCTT CCAGAGGACTATAGGGATCATTGTCAGGTAATATTATTGTCTCTTGTAATTAGTTCTCAAGTGAAAGTGAAAATACTGTG TGCTTATTTCTGCTGAAATAATCACATGAAGAGGGAGTTTAGTTCGATTGGTTCTTTGCCACTAAGATGCACTCGATACC AAGGTTAAtgaattacaaatttttactGACCCATAAAAGAAGCAAAttgtggaaaaataaaataagtgaaGGAAATGAAG GATAGTGAGTTTCGTAGGCTTTGTTTATTAGAACTTTCCATTCATTGCTTGGTAAGCTCTCAATTTAAACTTAGCCCAAT AGGGGGTGTAAATGAGACGTTTAGCTGGTGATCCTACAATATGGTAGGCCAATTTTTTGAAGGCCTAAGCTTGCGTATAT GCTTTAAATGAGTTGATGAACTATAATTTAACCAAACTCATTCATGTTTCAGCTTTTGGTTATTTCTTAAGCAAGCCTAA CACTTTGCTTAGAGGTTATCGATCAATACTCTTAAAACTTAAGATGATTGAGTTTCCAGCAAAGTTCTTGTCtgctataa aaatatagagagGAGATGGGCGGATATTTGTTCTGAAGTCTTTCCCACATGCATTTCCATGCATCCCCTTTTTAGATTAG TCTAATTAGAGTTTGAAAACCAATTTTGTTGATTGCCATTTTCACATTTGCCCTTTGGAATGACTGAGCGAGAAGGCAAG AGGCAAAAGAGAAAGTTATGCATTTAGGGTGAAATTGAACCCTATGTCAGAACTGCATAGTTTTGATATTGGTTTACTTA AACTTGGCTTGTAAGCTGGAGCTAAGCTCGAACTCGGCTCGTCTGTTAAAAGAGCTCAATAaaaaaagcttgagctcaaC TTGTTGGCCCGACTCATTTACAGCCCTACTGAAATGCACTCACTGCACATTCACATCATGTGGTCCGTTGTATACAAGCT TGAGCTCGGCTCGTTTGTTAAAAGAGCTCAATaaaaaagcttgagctcaaCTTGTTGGCCTGACTCATTTACAGCCCTAC TGAAATGCACTCACTGCACATTCACATCATGTGGTCCGTTGTATACAAGAAATGTTGAAGCCAGTATAATTATTGAATGG TATTATCAATAGTGCAAACTTCTAATCCAGATGATTACACTTAGGTATCAAATGAGTCTAATATTCATCTAAATAATGCA GGATATATTATGTAATGATTGTGATCGAAAGGGCACTGCACGTTTCCACTGGTTATATCACAAGTGTGGAGTTTGTGGTT CGTACAACACTCGGGTGATCAAGAGTGAGACAGTAAAGCCCAACTCTGCTCCACCTTAATGAGACTCACATTTTGATGAG TTATAGGTATTAGGCTGTATATACTTTGTCAATCCGATCAATTTTCCCTCTTGAAGGAGAGGTGATTTCTTgtcattttt tgtttcttgcacCAAAAATTCATCACCCTTATAGAAACTCTTTAGGATGATTTTCTCTTGCTTGAGTTCCTCAGTTGGTG TAGATGAGCAAAATTAGGAGATCTTTTGGTTCTGATTTACTTCATTATGTATAGAATAGAAAATGTTCTGTGTAAAGTAC GTCTTTTCATGTCGAAGAGGACCCGGCTTATGAACT
Product
uncharacterized LOC105650696
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237640.1
JCDBP29706
ID
JCDBP29706
Parent
JCDBR33775
Name
XP_012093030.1
Scaffold
NW_012130064.1
CDS
864606-864743,865918-865989,866248-866307,866421-866655,866767-866904,866985-867206,867366-867537,867669-868910,869009-869177,869387-869615,870159-870526,870618-870812,872562-872771,873744-874022
Strand:
-
Sequence
MATPLPELQRGEGMILSSAVKNVEAKGCLESNEQKSPILIFLYFHKAIRNELDSLHRLAMAFATGQTVDVESLFERYRFL RLIYKHHCNAEDEVIFPALDIRVKNVAQTYSLEHKGESSLFDQLFELLNSYTQDDESFPRELASCTGALQTSLSQHMAKE EEQVFPLLIEKFSLEEQASLIWQFVCSIPVNIMSELMPWLASSISPIESQDMQKCLSKIIPEEKLLQQVVFTWIRGRNGA KEVGSCTDNHQDQYCVNYTISAMNSELGDVMGTCDEHKIGKRKYLESSNDASDTTGTHPINEIMLWHNAIKQELNEIAEE ARKIQLSGDFMNLSAFDDRLQFIAEVCIFHSIAEDKVIFPAVDGEFSFFQEHAEEESQFDEIRRLIESIQRAGANSNSAA EFYAKLCSQADQIIDTIQRHFYNEEIQVLPLARKHFSFKRQQELLYQSLCVMPLKLIERVLPWLVGFLTEDEAKNFLINM QSAAPLTDTALITLFTGWACKGRSRGACLSSAIGCFSAKNFTDIEEDIVRSCCACTSAFCSKDCVVSVCEDDNKRPVKRN IPLSCKNSNAPDLSRTLSSHTPSCADRSCCVPGLGVNSNNLGLNSLSTAKSLRSLSFSSSAPALNSSLFSWEADNSSFDI GRAERPIDTIFKFHKAISKDLEYLDVESGKLSDCDETILQQFVGRFRLLWGLYRAHSNAEDDIVFPALESKEALHNVSHS YTLDHKQEEKLFEDISYVLSELSSLHEILQKARMMEDSVRSNVELSVAHDGIDDCVAKYGELATKLQGMCKSIRVTLDHH ILREEVELWPLFGKHFSVQEQDKIVGRIIGTTGAEVLQSMLPWVTSALTQDEQNKMMDTWKQATKNTMFSEWLNECWKGP AELSLQAETSEARIPREDKEFQESLEQSDQMFKPGWKDIFRMNQNELESEIRKVYKDATLDPRRKSYLVQNLLTSRWIAA QQKLPQGISGETSNGGDIMGCSPSFRDQEKQIFGCEHYKRNCKLRAACCGKLFTCRFCHDKVSDHSMDRKATSEMMCMRC LKIQAVGPICTTPACNGLLMAKYYCNICKFFDDERRVYHCPFCNLCRVGKGLGIDYFHCMTCNCCLGIKLVNHKCLEKGL ETNCPICCDFLFTSSATVRALPCGHYMHSACFQAYTCSHYICPICSKSLGDMAVYFGMLDALLAAEELPEDYRDHCQDIL CNDCDRKGTARFHWLYHKCGVCGSYNTRVIKSETVKPNSAPP
Product
uncharacterized protein LOC105650696
Source
Gnomon
Link
XP_012093030.1
InterProScan
IPR001841 Zinc finger, RING-type
IPR004039 Rubredoxin-type fold
IPR008913 Zinc finger, CHY-type
IPR012312 Haemerythrin-like
IPR013083 Zinc finger, RING/FYVE/PHD-type
IPR017921 Zinc finger, CTCHY-type
Pfam
PF01814.19 Hemerythrin Domain
PF01814.19 Hemerythrin Domain
PF05495.8 zf-CHY Domain
PF14599.2 zinc_ribbon_6 Domain