Detail information of JCDBG25289

JCDBG25289
ID
JCDBG25289
Name
LOC105650697
Type
protein_coding
Scaffold
NW_012130064.1
Start
885291
End
889295
Strand
-
Link
Genbank id:105650697 | Jatropha Genome Database ID:Jcr4S03834.30
Molecular function
Cellular component
Biological process
GO:0016226 | iron-sulfur cluster assembly
KEGG
Entry: K09015
Name: sufD
Definition: Fe-S cluster assembly protein SufD
Source
Gnomon
TF
Description
protein
Sequence
ttattttatttattttctggttctcttcttcttcctagTTTGGTTTTGTCCAATGTGCAGAGGGGCTTGCCATTACAACA TTGTTCATTTCAGTATCTTTCTCTGTCACTATAGGCTCTAACAAAATCCATGTCTTCCCTATTATTCGCACCCCAAATTC AGTTTCTCAAAGCCAAACCCACACCCAGGCTGAAACACAAAGTCAAAACCAGTCTTTCACTCTCCACAACCCCAACAATA CAAGCCAGTTTCTCTGACCCTTTCGTTCTCCAACTTGCAGAAACTCTTGAAGATTCCCTCTCCCCTTCTCCTACTCCTCC TCTCCAGAAACTAAGGGACTCTTCCTCTGAATCCCTTCTCTCCACTCCTTGGCCCTCTCGCAAAGATGAATCCTTTAGGT TTACGGACACTTCGTTTATTAAGAAATCTCAAATTCATCCAATCTCTAATCCACCACGAGAACAAGACTTACCAAACATT TCTAAAGAAACCCAGTTGCCTAATATTGTAATTGTTGACGGGTTTGTCTTAAATTCCATGTTGAATTCGCCCAATTTGCC TGATGGGGTTTATGTGGGTAGCTTGTTAAGTGACTCCAATGATAAAATTGCCAAAATTGTGTCCAATTTTGTTGATGATT TTCAATGTGGTGATGTGTTTTGGTCTATTAATGGATTAGGAGCACCTGATTTGGCTGTGGTTTATATTCCTGCTGGGGTT AGAGTGGAAAGTCCAATACATTTGCGTTACGTTTCTCTCGAGGGAGGAGAAGAGGGGTCTAATAAGTTGCCCGTTTCAAA TCCAAGAGTGCTTGTAGTGGTGGAGGAGGGCGGAGAGGTTGGGATAATTGAGGAGTTTGTTAGTGTAGGAAGTGATGACA AATGTTATTGGGCAAATTCAGTTTTGCAAGTCATTATTGAAGAAGGATCAAAAGTTAAGCATTCTTATATACAGAGTCAA TCCTTAAATTCTGCCCATATCAAGTGGACTTATGTTCAACAGGTGAGTTTTTGTTGCATTATttgcttctctttttattc tttgggcctttgcctttttttttttttttttttttggtctcAATTTAGTTTATACAGAGTATATTCTTCATGTTCAATTT TGAGAAGATGATagaattgaataaaaatgaatgtGTTAATGGtttggttttgaaatttaaaatgcttGTTTTCAGAATGT ATTAATGCTTGAATAtgcttttatataaaataaatttcacattaAAGACCGATAACATGATAATTTGGTATCGAAGTGGA AAACATTAGAtgtgcatgattttggttaGAATTCTGACGGTTTGAAGTTTGAACTAGTTCTTAAAGGATGTGGGATACTA TTTTGGTACATAGTCTGAATACGTAAGTAAATTGAAATACATTTGTGTGCTTTACCCAAGCCTTGTACAATATGAAAATT GCTTACTATTGTCACTTTTGAGATTTAAAACAGGATGCATGTGTGGCTATCACTAGATTTTGAAGTATAGCACTTATATG TTGCAGAAGTTAATTTGCCTTTTCTCGATGAATAGATTTATGTCTTTGCTGGTTTTGACCAGCTCAGTATCATAAATGTA AATGGCTCGGCTAGCCCTTGTTTATGCaaaatttatctttctttgattcaaaaattgatttcccattgttcttttttcta tttttatcaagaTTCTTGTCATTGTTTTCAAAGAAGGAATTCTTAAGACAAATGTTTCCATTGCCTTGAATGGGGACATG GGCGCAGTAGAAGAGGGGGGTTGTAGCCGGAACTTATGATATTATGGGAATAGAAGGTGTGTGGTGGGGGCACAACACAA GATTGTCGTACTGTGGGGACATTAGAATGTCATTTATAGTTATGAGGTTAACTCTTCATGcctgtgatatatatattttc tcctAAGTCAAGTAGTATCTCTTATCAGTTTTGCTAAtatagtattaaatttattgtctttaattttgtcaattaaaTCT AACTTAATTggtgtctctctctctcttttgaaTTTCTCATTTGTTAGTACATTAAGAGGTTCTTTTGGACAAACATGAAA ATGGCATTAGTGTCAGAATATGGAAATACATAAGAACTTATCGGAAAGAATTGGCTTTgctgaagttaaattaaaggatt ttcactttctaatATAAGAGTTATTAATATGAGAACTTCCTGTCGTATAATATGATCAGAGACAGTCTATTTGTACCCTT TACTAAGTAGGGGCTCGAAAGAAAGTTAAAAGTTATGCCTTGTAATTTGCTTGACAGTACTATTCACAAAAAGGCACAAG AAGGGTATTTGTTGCAAATAACCATGGGATTCTGACAGCCACAGACGCTGCTTCTCTAATTGAAGGCATAGTAGATGGCA TCCATGCCTCTGTCTTAGCactttaatcattttatatgtGCCTGCAGAAACATTAATCTTGTTATAGGTGATGATACTCA TACTATTGATACCTGTACAACTATCTGGCTAGGACTTGTGATATTATTCAGTCCATTTTGTAACTGTACTAATATTACAT GTTGTGTTTTACCTATGCATAACTGCAAAAGCATATGGTTCAGTGCTTCATGCTTATCTAAGACATTGTCTAtggataga aaaaaaaaatctgtacTTTGCTGATGGTGTTGGAATAGAAGCAAGGTGTgagtaaattaaaatgaaatttgactTAAATT TGATTGTTTGCAGAAATCAAGTAGCACCTATGAACTTGTTGAGGTAAGCACTGGCGGAAAATTAAGTAGGCATAACCTTC ATGTTCAGCAACTAGGCCCAGATACATCAACAGAGTTATCAACATTCCATTTGTCTGTTGATGGTCAAACACAAGATCTA CATAGTAGGCTTGTCTTGGATCATCCAAGGGCTTATTCTCGACAACTTCACAAGTGCATAGTTGCTCATTCACTAGGCCA AGCTGTCTTTGATGGGAATATAAAGGTCAACAGGTAGTGTTATCTCCAGTTTTTTGTTCTCTCATCGCTCTGGCTAATAA TGTCTTGCTTCACTTCTATGCTGTGTATCATCTTCTTGCATCAGGGTTCTAAGATTACCTGAATAGAATTTACTAAATAG CATATGCATTCTAGACCCGTTAAAATGtgattatttctattttgggtGAAACAATGGGACCTATATCATGGGTTTGCTTC ATTGTGATTAGACATAATCCCAGTGCAATGTCAATCCAAAATCAGTATTTGGTGGCTTTTCATTCAGTGAAGTTCACGCT ATAAGCTTGTCTAGCAGTTAAATTGGAGATATAAAGTCATAGTATTGTTGTATACAACTAATGCTGTTCCTTTGGAAAAT TAATCTTATATACAtctgaagaaagaaagaggagagAAACTCACTGAAACCAGTCTATGATAGTGCATATAATAGGCTGT GATGACAGGGAATTGGAGTAGGAGAACCGATTAAGCGACTCTGGTCCATCCTATATTTGTTCTGATGACTTTTACTTTTG GTTGCTGATAGCTAGAACACGGTTCAAAAGGTGTTAATGGACAGTCAAATATCTGTTGCATCTTACATCCATTTTGCAGA TATGCACAACAAACTGATGCTGGACAATTAACGAGGAGCCTCCTTCTGGAACCACGAGCAACTGTAAATGTCAAACCCAA TTTGCAAATAATAGCAGATGATGTCAAATGCTCCCACGGAGCTGCAATAAGCGATCTAGAAGAAAGCCAGCTGTTCTACT TTCAGGCACGTGGTATTGATTTAGAGACGGCTAGAAAGGCTCTTGTATTTTCCTTCGGGGCTGAAGTGATTGAACGATGC ccttattcttttattagacAGCAAGCTGAGAGACATGTGAAAGAATTGCTAACTTCCTCTGGTCAAGGATCGTCATAGAA AACTCGATCGCGTTATTAGCATTGTTTGACAGGAGGAAAATTTGTTATCAGTCatttaattgaagaaaattttgtttttg tatta
Gene structure

JCDB Genes gff download

JCDBG25289 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG25289's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG25289JCDBG08056co-exp0.88371
JCDBG25289JCDBG24701co-exp0.863699
JCDBG25289JCDBG05871co-exp0.861749
JCDBG25289JCDBG10940co-exp0.846475
JCDBG25289JCDBG16931co-exp0.846229
JCDBG25289JCDBG14028co-exp0.841127
JCDBG25289JCDBG14348co-exp0.839579
JCDBG25289JCDBG21671co-exp0.837341
JCDBG25289JCDBG17554co-exp0.830786
JCDBG25289JCDBG24579co-exp0.830182
JCDBG08056JCDBG24701co-exp0.833517
JCDBG08056JCDBG05871co-exp0.887533
JCDBG08056JCDBG10940co-exp0.80206
JCDBG08056JCDBG16931co-exp0.883053
JCDBG08056JCDBG14028co-exp0.790236
JCDBG08056JCDBG14348co-exp0.820329
JCDBG08056JCDBG21671co-exp0.879681
JCDBG08056JCDBG17554co-exp0.788756
JCDBG08056JCDBG24579co-exp0.766941
JCDBG24701JCDBG05871co-exp0.847352
JCDBG24701JCDBG10940co-exp0.841886
JCDBG24701JCDBG16931co-exp0.912411
JCDBG24701JCDBG14028co-exp0.753775
JCDBG24701JCDBG14348co-exp0.8468
JCDBG24701JCDBG21671co-exp0.844926
JCDBG24701JCDBG17554co-exp0.754936
JCDBG24701JCDBG24579co-exp0.797299
JCDBG05871JCDBG10940co-exp0.813784
JCDBG05871JCDBG16931co-exp0.901774
JCDBG05871JCDBG14028co-exp0.778526
JCDBG05871JCDBG14348co-exp0.843315
JCDBG05871JCDBG21671co-exp0.897863
JCDBG05871JCDBG17554co-exp0.829164
JCDBG05871JCDBG24579co-exp0.758865
JCDBG10940JCDBG16931co-exp0.85755
JCDBG10940JCDBG14028co-exp0.792956
JCDBG10940JCDBG14348co-exp0.768561
JCDBG10940JCDBG21671co-exp0.802912
JCDBG10940JCDBG17554co-exp0.790428
JCDBG10940JCDBG24579co-exp0.682237
JCDBG16931JCDBG14028co-exp0.724601
JCDBG16931JCDBG14348co-exp0.843716
JCDBG16931JCDBG21671co-exp0.855799
JCDBG16931JCDBG17554co-exp0.734546
JCDBG16931JCDBG24579co-exp0.73735
JCDBG14028JCDBG14348co-exp0.635119
JCDBG14028JCDBG21671co-exp0.808115
JCDBG14028JCDBG17554co-exp0.814197
JCDBG14028JCDBG24579co-exp0.691357
JCDBG14348JCDBG21671co-exp0.767337
JCDBG14348JCDBG17554co-exp0.701487
JCDBG14348JCDBG24579co-exp0.801865
JCDBG21671JCDBG17554co-exp0.818574
JCDBG21671JCDBG24579co-exp0.736302
JCDBG17554JCDBG24579co-exp0.635689
PPI network
node1node2type
JCDBG25289JCDBG23945PPI
JCDBG25289JCDBG18671PPI
JCDBG23945JCDBG18671PPI
JCDBR33777
ID
JCDBR33777
Name
XM_012237641.1
Type
Scaffold
NW_012130064.1
Start
885291
End
889295
Strand
-
Exon
885291-885697,886304-886563,888295-889295
Sequence
ttattttatttattttctggttctcttcttcttcctagTTTGGTTTTGTCCAATGTGCAGAGGGGCTTGCCATTACAACA TTGTTCATTTCAGTATCTTTCTCTGTCACTATAGGCTCTAACAAAATCCATGTCTTCCCTATTATTCGCACCCCAAATTC AGTTTCTCAAAGCCAAACCCACACCCAGGCTGAAACACAAAGTCAAAACCAGTCTTTCACTCTCCACAACCCCAACAATA CAAGCCAGTTTCTCTGACCCTTTCGTTCTCCAACTTGCAGAAACTCTTGAAGATTCCCTCTCCCCTTCTCCTACTCCTCC TCTCCAGAAACTAAGGGACTCTTCCTCTGAATCCCTTCTCTCCACTCCTTGGCCCTCTCGCAAAGATGAATCCTTTAGGT TTACGGACACTTCGTTTATTAAGAAATCTCAAATTCATCCAATCTCTAATCCACCACGAGAACAAGACTTACCAAACATT TCTAAAGAAACCCAGTTGCCTAATATTGTAATTGTTGACGGGTTTGTCTTAAATTCCATGTTGAATTCGCCCAATTTGCC TGATGGGGTTTATGTGGGTAGCTTGTTAAGTGACTCCAATGATAAAATTGCCAAAATTGTGTCCAATTTTGTTGATGATT TTCAATGTGGTGATGTGTTTTGGTCTATTAATGGATTAGGAGCACCTGATTTGGCTGTGGTTTATATTCCTGCTGGGGTT AGAGTGGAAAGTCCAATACATTTGCGTTACGTTTCTCTCGAGGGAGGAGAAGAGGGGTCTAATAAGTTGCCCGTTTCAAA TCCAAGAGTGCTTGTAGTGGTGGAGGAGGGCGGAGAGGTTGGGATAATTGAGGAGTTTGTTAGTGTAGGAAGTGATGACA AATGTTATTGGGCAAATTCAGTTTTGCAAGTCATTATTGAAGAAGGATCAAAAGTTAAGCATTCTTATATACAGAGTCAA TCCTTAAATTCTGCCCATATCAAGTGGACTTATGTTCAACAGGTGAGTTTTTGTTGCATTATttgcttctctttttattc tttgggcctttgcctttttttttttttttttttttggtctcAATTTAGTTTATACAGAGTATATTCTTCATGTTCAATTT TGAGAAGATGATagaattgaataaaaatgaatgtGTTAATGGtttggttttgaaatttaaaatgcttGTTTTCAGAATGT ATTAATGCTTGAATAtgcttttatataaaataaatttcacattaAAGACCGATAACATGATAATTTGGTATCGAAGTGGA AAACATTAGAtgtgcatgattttggttaGAATTCTGACGGTTTGAAGTTTGAACTAGTTCTTAAAGGATGTGGGATACTA TTTTGGTACATAGTCTGAATACGTAAGTAAATTGAAATACATTTGTGTGCTTTACCCAAGCCTTGTACAATATGAAAATT GCTTACTATTGTCACTTTTGAGATTTAAAACAGGATGCATGTGTGGCTATCACTAGATTTTGAAGTATAGCACTTATATG TTGCAGAAGTTAATTTGCCTTTTCTCGATGAATAGATTTATGTCTTTGCTGGTTTTGACCAGCTCAGTATCATAAATGTA AATGGCTCGGCTAGCCCTTGTTTATGCaaaatttatctttctttgattcaaaaattgatttcccattgttcttttttcta tttttatcaagaTTCTTGTCATTGTTTTCAAAGAAGGAATTCTTAAGACAAATGTTTCCATTGCCTTGAATGGGGACATG GGCGCAGTAGAAGAGGGGGGTTGTAGCCGGAACTTATGATATTATGGGAATAGAAGGTGTGTGGTGGGGGCACAACACAA GATTGTCGTACTGTGGGGACATTAGAATGTCATTTATAGTTATGAGGTTAACTCTTCATGcctgtgatatatatattttc tcctAAGTCAAGTAGTATCTCTTATCAGTTTTGCTAAtatagtattaaatttattgtctttaattttgtcaattaaaTCT AACTTAATTggtgtctctctctctcttttgaaTTTCTCATTTGTTAGTACATTAAGAGGTTCTTTTGGACAAACATGAAA ATGGCATTAGTGTCAGAATATGGAAATACATAAGAACTTATCGGAAAGAATTGGCTTTgctgaagttaaattaaaggatt ttcactttctaatATAAGAGTTATTAATATGAGAACTTCCTGTCGTATAATATGATCAGAGACAGTCTATTTGTACCCTT TACTAAGTAGGGGCTCGAAAGAAAGTTAAAAGTTATGCCTTGTAATTTGCTTGACAGTACTATTCACAAAAAGGCACAAG AAGGGTATTTGTTGCAAATAACCATGGGATTCTGACAGCCACAGACGCTGCTTCTCTAATTGAAGGCATAGTAGATGGCA TCCATGCCTCTGTCTTAGCactttaatcattttatatgtGCCTGCAGAAACATTAATCTTGTTATAGGTGATGATACTCA TACTATTGATACCTGTACAACTATCTGGCTAGGACTTGTGATATTATTCAGTCCATTTTGTAACTGTACTAATATTACAT GTTGTGTTTTACCTATGCATAACTGCAAAAGCATATGGTTCAGTGCTTCATGCTTATCTAAGACATTGTCTAtggataga aaaaaaaaatctgtacTTTGCTGATGGTGTTGGAATAGAAGCAAGGTGTgagtaaattaaaatgaaatttgactTAAATT TGATTGTTTGCAGAAATCAAGTAGCACCTATGAACTTGTTGAGGTAAGCACTGGCGGAAAATTAAGTAGGCATAACCTTC ATGTTCAGCAACTAGGCCCAGATACATCAACAGAGTTATCAACATTCCATTTGTCTGTTGATGGTCAAACACAAGATCTA CATAGTAGGCTTGTCTTGGATCATCCAAGGGCTTATTCTCGACAACTTCACAAGTGCATAGTTGCTCATTCACTAGGCCA AGCTGTCTTTGATGGGAATATAAAGGTCAACAGGTAGTGTTATCTCCAGTTTTTTGTTCTCTCATCGCTCTGGCTAATAA TGTCTTGCTTCACTTCTATGCTGTGTATCATCTTCTTGCATCAGGGTTCTAAGATTACCTGAATAGAATTTACTAAATAG CATATGCATTCTAGACCCGTTAAAATGtgattatttctattttgggtGAAACAATGGGACCTATATCATGGGTTTGCTTC ATTGTGATTAGACATAATCCCAGTGCAATGTCAATCCAAAATCAGTATTTGGTGGCTTTTCATTCAGTGAAGTTCACGCT ATAAGCTTGTCTAGCAGTTAAATTGGAGATATAAAGTCATAGTATTGTTGTATACAACTAATGCTGTTCCTTTGGAAAAT TAATCTTATATACAtctgaagaaagaaagaggagagAAACTCACTGAAACCAGTCTATGATAGTGCATATAATAGGCTGT GATGACAGGGAATTGGAGTAGGAGAACCGATTAAGCGACTCTGGTCCATCCTATATTTGTTCTGATGACTTTTACTTTTG GTTGCTGATAGCTAGAACACGGTTCAAAAGGTGTTAATGGACAGTCAAATATCTGTTGCATCTTACATCCATTTTGCAGA TATGCACAACAAACTGATGCTGGACAATTAACGAGGAGCCTCCTTCTGGAACCACGAGCAACTGTAAATGTCAAACCCAA TTTGCAAATAATAGCAGATGATGTCAAATGCTCCCACGGAGCTGCAATAAGCGATCTAGAAGAAAGCCAGCTGTTCTACT TTCAGGCACGTGGTATTGATTTAGAGACGGCTAGAAAGGCTCTTGTATTTTCCTTCGGGGCTGAAGTGATTGAACGATGC ccttattcttttattagacAGCAAGCTGAGAGACATGTGAAAGAATTGCTAACTTCCTCTGGTCAAGGATCGTCATAGAA AACTCGATCGCGTTATTAGCATTGTTTGACAGGAGGAAAATTTGTTATCAGTCatttaattgaagaaaattttgtttttg tatta
Product
protein ABCI7%2C chloroplastic
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237641.1
JCDBP29708
ID
JCDBP29708
Parent
JCDBR33777
Name
XP_012093031.1
Scaffold
NW_012130064.1
CDS
885379-885697,886304-886563,888295-889167
Strand:
-
Sequence
MSSLLFAPQIQFLKAKPTPRLKHKVKTSLSLSTTPTIQASFSDPFVLQLAETLEDSLSPSPTPPLQKLRDSSSESLLSTP WPSRKDESFRFTDTSFIKKSQIHPISNPPREQDLPNISKETQLPNIVIVDGFVLNSMLNSPNLPDGVYVGSLLSDSNDKI AKIVSNFVDDFQCGDVFWSINGLGAPDLAVVYIPAGVRVESPIHLRYVSLEGGEEGSNKLPVSNPRVLVVVEEGGEVGII EEFVSVGSDDKCYWANSVLQVIIEEGSKVKHSYIQSQSLNSAHIKWTYVQQKSSSTYELVEVSTGGKLSRHNLHVQQLGP DTSTELSTFHLSVDGQTQDLHSRLVLDHPRAYSRQLHKCIVAHSLGQAVFDGNIKVNRYAQQTDAGQLTRSLLLEPRATV NVKPNLQIIADDVKCSHGAAISDLEESQLFYFQARGIDLETARKALVFSFGAEVIERCPYSFIRQQAERHVKELLTSSGQ GSS
Product
protein ABCI7%2C chloroplastic
Source
Gnomon
Link
XP_012093031.1
InterProScan
IPR000825 SUF system FeS cluster assembly, SufBD
IPR011542 SUF system FeS cluster assembly, SufD
Pfam
PF01458.13 UPF0051 Family