Detail information of JCDBG25291

JCDBG25291
ID
JCDBG25291
Name
LOC105650699
Type
protein_coding
Scaffold
NW_012130064.1
Start
906188
End
909542
Strand
+
Link
Genbank id:105650699 | Jatropha Genome Database ID:Jcr4S05943.70
Molecular function
GO:0005488 | binding
Cellular component
GO:0030117 | membrane coat
Biological process
GO:0006886 | intracellular protein transport
GO:0016192 | vesicle-mediated transport
KEGG
Entry: K12396
Name: AP3D
Definition: AP-3 complex subunit delta
ko04142:   Lysosome
Source
Gnomon
TF
Description
AP-3
Sequence
CAGACCAAGATGATTAACCACTGAAATACTCTCAAATCCCAAATCATAATTCTCTCATCCATAGCCaacttcttctcttc tctgcAGATTGCTCCCTTCTCTGTGAATGCCTCGATTCGACGCGTAAACACAAAACCCCAGCTATCTCTCACTGCCTCTC TCTCGGATGGCGTCTCCTTCGCTAATGGATACTCTTTTCCAGCGCACACTAGATGATATAATCAAAGGCCTCCGCCACCA ACAAACCGGCGAGTCGGCATTCATTTCCAAAGTTATGGAAGAAATTCGACGAGAGATCAAATCCACCGACTTGCATACCA AATCCATAGCTCTGCACAAACTCACATATCtaaattcaattcattttattGACATTTCATGGGCTGCTTTTCACGCCATT GAGTGTATATCTTCTCCCAATTTCTCTCACAAGAAGATTGGTTACCTTGCGATCTCTCAGTCCTTCAACGAATCAACACC AGTAATTTTGTTGATCACAAATCAATTGAGGAAAGATCTTAGGAGTAATAATGAGTTTGAGGTTAGTTTAGCTCTTGAAT GCTTATCTACAATTGGTACTGTTGATTTGTGTAGAGATCTTACTCCTGAAGTTTTTACTTTAATGTCAAGTTCCAAGCTC TTGGTTAGAAAGAAAGCTTTAGGTGTGATTTTAAGGGTTTTTGGTAAATACCCAGATGCTGTTAGGGTTTGTTTTAAGAG ATTAGTTGAATGTTTAGATGGTACTGATCAACAGATTGCTTCTGCAGTAATTGGGGTGTTTTGTGAGCTTGCTTCGAAAG ACCCAAGATCATATCTTCCTTTAGCACCTGAATTTTACAGGGTTTTGGTTGATTCGAGGAACAATTGGGTTTTGATTAAA GTATTGAAGATTTTTGCAAAGTTGGCTCCTTTAGAGCCTAGATTGGCTAAGAGAGTTGTTGAACCAATCTGTGATATCAT GAGGAGAACTGGAGCAAAATCATTGATGTTTGAGTGTATCAGGACTGTGGCAACTAGTTTCACTGATTATGAATCTGCAG TAGAGCTAGCTGTTGCAAAAAATGGTGAGTTTTTGACAGACGATGATCCAAACCTTAAATATCTTGGATTGCATGTGCTA TCAATTATAGCGCCAAAGCATTTGTGGGCAGTGTTGCAGAATAAAGAGGTTGTGATTATGTCTTTGAGTGATGCTGATCC TAATATAAAACTTGAGTCATTGCGGCTAGTTATGGCAATGGTGTCTGAGAGTAATGTGGTGGAATTTTGCAGGGTTTTGG TCAACTATTCACTTAAATCTGATCCTGAGTTCTGCAATGAGATTCTTGGTTCAATTTTGTCCAGGTGTCGCCAGAATTTT TATGAGATTATAGTTGACTTTGATTGGTATGTGTCACTTCTTGGGGAAATATCAAGGATTCCACATTGCCAAAAGGGGGA AGAAATTGAGAATCAACTTATTGACATAGGTATGAGGGTTAAGGATGTTAGACTACCGCTTGTTCATGTTGGTCGTGACC TGCTGATTGATCCTGCGTTACTTGGGAATCCTTTCTTGCACAGGATATTATCTGCTGCTGCTTGGGTGTGTGGCGAGTAT gtgaaattttcaaagaaCCCAGTGGAACTTGTGGAAGCACTACTGCAGCCTCGCACTAGTCTCTTGCCTCCATCAGTCAG AACTGTTTACATGCAATCTgcttttaaaatcttaatattttgcCTACATTTTTACCTCTTACAAAGGGGATGTATTGCTG ATGATAAGGCGTCAGAAGTTATGGATTTGGCATCCCAAAGGGAATGCTCAGGAATGTCTGATTTGGCAACACACAAAGCA TCTGCCTGTTATGAACAGGAGGAAGGATTCAATCCAAGGGATTCGAATAGATCATATGAAGATCTTTCTATTATAGATGG TGGAGATGATCAAACAACTTCTTCTCCTGGGAAAAGTCTCACACATGAATCTTTTTCTAACCTGTTAACCTTAATTGAAT TGGCCTTGAATCCACTATCTAGAAATTATGATGTTGAAGTACAGGAGCGAGCACGGAATATACTGGGATTTGTTGAATTG ATAAAGCAACAAATATCCGATTGTTTCTTCCCCAAGGACGTGAATTTGAAGAAGGAAGATGTGAAAGTATTCAAATTTGT TGAGTTGGTGTATGATGCTTTCGCGGAGGAGCTTGGTCCAGTGTCTGTAAATGCTCAAGAGAGAGTTCCTGTACCAGATG GGTTAATGCTTAAGGAGAATCTTTCGGACTTGGAAGCAATTTGTGGAGATGTACAACTACCTTCATCAAGTTCGTTTTCT CTGGGAAGTCCTTATGGGGAAGATGTTGGTGCTTCTCCCATTACCCAAAGCAAAGAAGAGTCAGAACCATCAAGTGAGTC CACTTCATTGCTTGCTGAACATCGTAAGCGACATGGATTATATTATCTTCCTtcagagaaaaatgaaatcttAGCAAATG ATTATCCACCGGCCAATGACCTTAAATCCAGTATTGACACCCATGATGATGCTCAAGATCTAGTTAAGCTTGCTGACCAA TCACTTGTATCAAAGAGAAAGTCAAGCCTTGCAAAGCCTCGGCCGGTGGTGGTGAAGTTGGATGAGGGAGATGTACCCCT AACTGCCAAGAAACCAGATAGACAAGATGGTTTACTTTCTGGTGCTGTTCGAGATATTCTTTTAGCTAATCCATCTGATG AGACATCTAGTAATAGAAAAGGGAAGGAGAAACAGAATGTTGATCCTCTTGAATCGAGAGAAATATTGGGTGGAGAAAAG CCTGACCTTGGAAATCCAAGTTCTAGAAGAAGCAAACACCGGAGCCATGGTAAAGAGAAAGGCACGAAAAGTGTAGAGAA GAAGAATGCCGATGAAAATGATGATCatggagagaaagaaaagcatAAGAGTAGACATCGCCATGGCAGGCATAAAACTC GACAAAGAGCTGATGCGCCAACCTTAACTGTGGTCACACAAACACCAGTAATTCCTGATTTCCTTCTATAGCATTGAATT TATGTTTCAATGCTTCTCTTGTGGCTCCTGAGAACTTGGTTGATGTGACCACACTGTAATCTGCCACCTTGACTGCTAAG GTTAgtgtttttttcttatagatTTGGtacattatttttggttaCATTTTTTGGTTTCTTGGATAAACATCTAAACTTTG GGATTTGTTTTACATGTTACACATTGTGAAAAAGATTTAGAACCTGAATTGTAGTCTGTAGAAATTGAGATTGTCAGTTG GAAAAAGAAgggatttttttgttttcttcttcaaaaagGGAAAGAACTATAGTGCCTGAAATCAACCATTTGAAT
Gene structure

JCDB Genes gff download

JCDBG25291 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG25291's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG25291JCDBG09552co-exp0.779001
JCDBG25291JCDBG01591co-exp0.778063
JCDBG25291JCDBG17148co-exp0.771064
JCDBG25291JCDBG22518co-exp0.770935
JCDBG25291JCDBG21381co-exp0.769833
JCDBG25291JCDBG14562co-exp0.761012
JCDBG25291JCDBG24654co-exp0.749452
JCDBG25291JCDBG14189co-exp0.748756
JCDBG25291JCDBG02723co-exp-0.747346
JCDBG25291JCDBG19229co-exp-0.745208
JCDBG09552JCDBG01591co-exp0.733403
JCDBG09552JCDBG17148co-exp0.807175
JCDBG09552JCDBG22518co-exp0.820581
JCDBG09552JCDBG21381co-exp0.73491
JCDBG09552JCDBG14562co-exp0.730665
JCDBG09552JCDBG24654co-exp0.772091
JCDBG09552JCDBG14189co-exp0.636966
JCDBG09552JCDBG02723co-exp-0.608946
JCDBG09552JCDBG19229co-exp-0.668469
JCDBG01591JCDBG17148co-exp0.766722
JCDBG01591JCDBG22518co-exp0.768788
JCDBG01591JCDBG21381co-exp0.729776
JCDBG01591JCDBG14562co-exp0.763012
JCDBG01591JCDBG24654co-exp0.8678
JCDBG01591JCDBG14189co-exp0.803077
JCDBG01591JCDBG02723co-exp-0.747816
JCDBG01591JCDBG19229co-exp-0.685329
JCDBG17148JCDBG22518co-exp0.875868
JCDBG17148JCDBG21381co-exp0.791567
JCDBG17148JCDBG14562co-exp0.704632
JCDBG17148JCDBG24654co-exp0.796168
JCDBG17148JCDBG14189co-exp0.677917
JCDBG17148JCDBG19229co-exp-0.606803
JCDBG22518JCDBG21381co-exp0.724268
JCDBG22518JCDBG14562co-exp0.746755
JCDBG22518JCDBG24654co-exp0.798687
JCDBG22518JCDBG14189co-exp0.713057
JCDBG22518JCDBG02723co-exp-0.619464
JCDBG22518JCDBG19229co-exp-0.71927
JCDBG21381JCDBG14562co-exp0.703636
JCDBG21381JCDBG24654co-exp0.725216
JCDBG21381JCDBG14189co-exp0.69449
JCDBG21381JCDBG02723co-exp-0.658921
JCDBG21381JCDBG19229co-exp-0.715527
JCDBG14562JCDBG24654co-exp0.835115
JCDBG14562JCDBG14189co-exp0.812539
JCDBG14562JCDBG02723co-exp-0.662121
JCDBG14562JCDBG19229co-exp-0.705224
JCDBG24654JCDBG14189co-exp0.812944
JCDBG24654JCDBG02723co-exp-0.722745
JCDBG24654JCDBG19229co-exp-0.711599
JCDBG14189JCDBG02723co-exp-0.683571
JCDBG14189JCDBG19229co-exp-0.705167
JCDBG02723JCDBG19229co-exp0.674563
PPI network
node1node2type
JCDBG25291JCDBG11845PPI
JCDBG25291JCDBG07353PPI
JCDBG25291JCDBG03896PPI
JCDBG25291JCDBG18154PPI
JCDBG25291JCDBG09911PPI
JCDBG25291JCDBG07882PPI
JCDBG25291JCDBG05386PPI
JCDBG25291JCDBG09750PPI
JCDBG25291JCDBG01246PPI
JCDBG25291JCDBG00355PPI
JCDBG25291JCDBG19426PPI
JCDBG25291JCDBG00849PPI
JCDBG25291JCDBG17543PPI
JCDBG25291JCDBG24479PPI
JCDBG25291JCDBG01279PPI
JCDBG25291JCDBG19466PPI
JCDBG25291JCDBG13635PPI
JCDBG25291JCDBG18159PPI
JCDBG25291JCDBG11887PPI
JCDBG25291JCDBG17451PPI
JCDBG25291JCDBG03395PPI
JCDBG25291JCDBG04297PPI
JCDBG25291JCDBG23175PPI
JCDBG25291JCDBG22378PPI
JCDBG25291JCDBG09325PPI
JCDBG25291JCDBG07695PPI
JCDBG25291JCDBG20171PPI
JCDBG25291JCDBG03445PPI
JCDBG25291JCDBG18174PPI
JCDBG25291JCDBG07761PPI
JCDBG25291JCDBG23983PPI
JCDBG25291JCDBG17535PPI
JCDBG25291JCDBG02472PPI
JCDBG25291JCDBG18045PPI
JCDBG25291JCDBG23088PPI
JCDBG25291JCDBG10201PPI
JCDBG25291JCDBG13526PPI
JCDBG25291JCDBG22101PPI
JCDBG25291JCDBG02988PPI
JCDBG25291JCDBG22097PPI
JCDBG25291JCDBG17960PPI
JCDBG25291JCDBG22161PPI
JCDBG25291JCDBG24990PPI
JCDBG25291JCDBG04306PPI
JCDBG25291JCDBG20355PPI
JCDBG25291JCDBG23582PPI
JCDBG25291JCDBG06359PPI
JCDBG11845JCDBG01246PPI
JCDBG11845JCDBG24479PPI
JCDBG11845JCDBG22378PPI
JCDBG11845JCDBG07695PPI
JCDBG11845JCDBG18174PPI
JCDBG11845JCDBG23088PPI
JCDBG11845JCDBG24990PPI
JCDBG07353JCDBG22161PPI
JCDBG03896JCDBG01246PPI
JCDBG03896JCDBG00355PPI
JCDBG03896JCDBG09325PPI
JCDBG03896JCDBG07695PPI
JCDBG03896JCDBG18174PPI
JCDBG03896JCDBG17535PPI
JCDBG03896JCDBG23088PPI
JCDBG03896JCDBG24990PPI
JCDBG18154JCDBG01246PPI
JCDBG18154JCDBG00355PPI
JCDBG18154JCDBG01279PPI
JCDBG18154JCDBG18174PPI
JCDBG18154JCDBG23088PPI
JCDBG09911JCDBG01246PPI
JCDBG09911JCDBG00355PPI
JCDBG09911JCDBG19426PPI
JCDBG09911JCDBG00849PPI
JCDBG09911JCDBG17543PPI
JCDBG09911JCDBG24479PPI
JCDBG09911JCDBG23175PPI
JCDBG09911JCDBG09325PPI
JCDBG09911JCDBG07695PPI
JCDBG09911JCDBG18174PPI
JCDBG09911JCDBG18045PPI
JCDBG09911JCDBG23088PPI
JCDBG09911JCDBG22097PPI
JCDBG09911JCDBG17960PPI
JCDBG09911JCDBG22161PPI
JCDBG07882JCDBG09750PPI
JCDBG07882JCDBG19426PPI
JCDBG07882JCDBG17543PPI
JCDBG07882JCDBG04297PPI
JCDBG07882JCDBG07695PPI
JCDBG07882JCDBG23983PPI
JCDBG07882JCDBG22097PPI
JCDBG07882JCDBG04306PPI
JCDBG07882JCDBG06359PPI
JCDBG05386JCDBG24479PPI
JCDBG05386JCDBG23175PPI
JCDBG05386JCDBG22378PPI
JCDBG05386JCDBG09325PPI
JCDBG05386JCDBG07695PPI
JCDBG05386JCDBG18045PPI
JCDBG05386JCDBG22161PPI
JCDBG05386JCDBG24990PPI
JCDBG09750JCDBG19426PPI
JCDBG09750JCDBG17543PPI
JCDBG09750JCDBG04297PPI
JCDBG09750JCDBG07695PPI
JCDBG09750JCDBG23983PPI
JCDBG09750JCDBG22097PPI
JCDBG09750JCDBG04306PPI
JCDBG09750JCDBG06359PPI
JCDBG01246JCDBG00355PPI
JCDBG01246JCDBG00849PPI
JCDBG01246JCDBG01279PPI
JCDBG01246JCDBG23175PPI
JCDBG01246JCDBG22378PPI
JCDBG01246JCDBG09325PPI
JCDBG01246JCDBG03445PPI
JCDBG01246JCDBG18174PPI
JCDBG01246JCDBG18045PPI
JCDBG01246JCDBG02988PPI
JCDBG01246JCDBG17960PPI
JCDBG01246JCDBG22161PPI
JCDBG00355JCDBG00849PPI
JCDBG00355JCDBG01279PPI
JCDBG00355JCDBG23175PPI
JCDBG00355JCDBG22378PPI
JCDBG00355JCDBG09325PPI
JCDBG00355JCDBG03445PPI
JCDBG00355JCDBG18174PPI
JCDBG00355JCDBG18045PPI
JCDBG00355JCDBG23088PPI
JCDBG00355JCDBG02988PPI
JCDBG00355JCDBG17960PPI
JCDBG00355JCDBG22161PPI
JCDBG19426JCDBG00849PPI
JCDBG19426JCDBG17543PPI
JCDBG19426JCDBG24479PPI
JCDBG19426JCDBG04297PPI
JCDBG19426JCDBG23175PPI
JCDBG19426JCDBG07695PPI
JCDBG19426JCDBG07761PPI
JCDBG19426JCDBG23983PPI
JCDBG19426JCDBG18045PPI
JCDBG19426JCDBG22097PPI
JCDBG19426JCDBG17960PPI
JCDBG19426JCDBG22161PPI
JCDBG00849JCDBG17543PPI
JCDBG00849JCDBG09325PPI
JCDBG00849JCDBG18174PPI
JCDBG00849JCDBG13526PPI
JCDBG00849JCDBG22097PPI
JCDBG17543JCDBG24479PPI
JCDBG17543JCDBG04297PPI
JCDBG17543JCDBG23175PPI
JCDBG17543JCDBG07695PPI
JCDBG17543JCDBG07761PPI
JCDBG17543JCDBG23983PPI
JCDBG17543JCDBG18045PPI
JCDBG17543JCDBG22097PPI
JCDBG17543JCDBG17960PPI
JCDBG17543JCDBG22161PPI
JCDBG24479JCDBG07695PPI
JCDBG24479JCDBG03445PPI
JCDBG24479JCDBG07761PPI
JCDBG24479JCDBG23088PPI
JCDBG24479JCDBG22097PPI
JCDBG24479JCDBG22161PPI
JCDBG24479JCDBG24990PPI
JCDBG01279JCDBG18174PPI
JCDBG01279JCDBG23088PPI
JCDBG19466JCDBG07695PPI
JCDBG19466JCDBG23088PPI
JCDBG19466JCDBG13526PPI
JCDBG19466JCDBG22101PPI
JCDBG13635JCDBG18159PPI
JCDBG13635JCDBG23175PPI
JCDBG13635JCDBG03445PPI
JCDBG13635JCDBG18045PPI
JCDBG13635JCDBG23088PPI
JCDBG18159JCDBG18045PPI
JCDBG18159JCDBG24990PPI
JCDBG17451JCDBG18045PPI
JCDBG17451JCDBG22161PPI
JCDBG04297JCDBG07695PPI
JCDBG04297JCDBG23983PPI
JCDBG04297JCDBG22097PPI
JCDBG04297JCDBG04306PPI
JCDBG04297JCDBG06359PPI
JCDBG23175JCDBG22378PPI
JCDBG23175JCDBG09325PPI
JCDBG23175JCDBG07695PPI
JCDBG23175JCDBG03445PPI
JCDBG23175JCDBG18174PPI
JCDBG23175JCDBG18045PPI
JCDBG23175JCDBG23088PPI
JCDBG23175JCDBG22097PPI
JCDBG23175JCDBG22161PPI
JCDBG23175JCDBG24990PPI
JCDBG22378JCDBG09325PPI
JCDBG22378JCDBG18174PPI
JCDBG22378JCDBG07761PPI
JCDBG22378JCDBG17535PPI
JCDBG22378JCDBG18045PPI
JCDBG22378JCDBG22161PPI
JCDBG22378JCDBG24990PPI
JCDBG09325JCDBG07695PPI
JCDBG09325JCDBG03445PPI
JCDBG09325JCDBG18174PPI
JCDBG09325JCDBG17535PPI
JCDBG09325JCDBG18045PPI
JCDBG09325JCDBG23088PPI
JCDBG09325JCDBG17960PPI
JCDBG09325JCDBG22161PPI
JCDBG09325JCDBG24990PPI
JCDBG07695JCDBG03445PPI
JCDBG07695JCDBG07761PPI
JCDBG07695JCDBG23983PPI
JCDBG07695JCDBG02472PPI
JCDBG07695JCDBG18045PPI
JCDBG07695JCDBG23088PPI
JCDBG07695JCDBG13526PPI
JCDBG07695JCDBG22101PPI
JCDBG07695JCDBG22097PPI
JCDBG07695JCDBG22161PPI
JCDBG07695JCDBG20355PPI
JCDBG20171JCDBG02472PPI
JCDBG03445JCDBG18174PPI
JCDBG03445JCDBG18045PPI
JCDBG03445JCDBG23088PPI
JCDBG03445JCDBG24990PPI
JCDBG18174JCDBG18045PPI
JCDBG18174JCDBG02988PPI
JCDBG18174JCDBG17960PPI
JCDBG18174JCDBG22161PPI
JCDBG07761JCDBG23088PPI
JCDBG07761JCDBG22097PPI
JCDBG07761JCDBG24990PPI
JCDBG23983JCDBG22097PPI
JCDBG23983JCDBG04306PPI
JCDBG23983JCDBG06359PPI
JCDBG02472JCDBG23088PPI
JCDBG18045JCDBG22097PPI
JCDBG18045JCDBG22161PPI
JCDBG18045JCDBG24990PPI
JCDBG18045JCDBG06359PPI
JCDBG23088JCDBG17960PPI
JCDBG23088JCDBG24990PPI
JCDBG23088JCDBG06359PPI
JCDBG13526JCDBG22101PPI
JCDBG13526JCDBG02988PPI
JCDBG22097JCDBG17960PPI
JCDBG22097JCDBG22161PPI
JCDBG17960JCDBG22161PPI
JCDBG22161JCDBG24990PPI
JCDBR33779
ID
JCDBR33779
Name
XM_012237643.1
Type
Scaffold
NW_012130064.1
Start
906188
End
909542
Strand
+
Exon
906188-909542
Sequence
CAGACCAAGATGATTAACCACTGAAATACTCTCAAATCCCAAATCATAATTCTCTCATCCATAGCCaacttcttctcttc tctgcAGATTGCTCCCTTCTCTGTGAATGCCTCGATTCGACGCGTAAACACAAAACCCCAGCTATCTCTCACTGCCTCTC TCTCGGATGGCGTCTCCTTCGCTAATGGATACTCTTTTCCAGCGCACACTAGATGATATAATCAAAGGCCTCCGCCACCA ACAAACCGGCGAGTCGGCATTCATTTCCAAAGTTATGGAAGAAATTCGACGAGAGATCAAATCCACCGACTTGCATACCA AATCCATAGCTCTGCACAAACTCACATATCtaaattcaattcattttattGACATTTCATGGGCTGCTTTTCACGCCATT GAGTGTATATCTTCTCCCAATTTCTCTCACAAGAAGATTGGTTACCTTGCGATCTCTCAGTCCTTCAACGAATCAACACC AGTAATTTTGTTGATCACAAATCAATTGAGGAAAGATCTTAGGAGTAATAATGAGTTTGAGGTTAGTTTAGCTCTTGAAT GCTTATCTACAATTGGTACTGTTGATTTGTGTAGAGATCTTACTCCTGAAGTTTTTACTTTAATGTCAAGTTCCAAGCTC TTGGTTAGAAAGAAAGCTTTAGGTGTGATTTTAAGGGTTTTTGGTAAATACCCAGATGCTGTTAGGGTTTGTTTTAAGAG ATTAGTTGAATGTTTAGATGGTACTGATCAACAGATTGCTTCTGCAGTAATTGGGGTGTTTTGTGAGCTTGCTTCGAAAG ACCCAAGATCATATCTTCCTTTAGCACCTGAATTTTACAGGGTTTTGGTTGATTCGAGGAACAATTGGGTTTTGATTAAA GTATTGAAGATTTTTGCAAAGTTGGCTCCTTTAGAGCCTAGATTGGCTAAGAGAGTTGTTGAACCAATCTGTGATATCAT GAGGAGAACTGGAGCAAAATCATTGATGTTTGAGTGTATCAGGACTGTGGCAACTAGTTTCACTGATTATGAATCTGCAG TAGAGCTAGCTGTTGCAAAAAATGGTGAGTTTTTGACAGACGATGATCCAAACCTTAAATATCTTGGATTGCATGTGCTA TCAATTATAGCGCCAAAGCATTTGTGGGCAGTGTTGCAGAATAAAGAGGTTGTGATTATGTCTTTGAGTGATGCTGATCC TAATATAAAACTTGAGTCATTGCGGCTAGTTATGGCAATGGTGTCTGAGAGTAATGTGGTGGAATTTTGCAGGGTTTTGG TCAACTATTCACTTAAATCTGATCCTGAGTTCTGCAATGAGATTCTTGGTTCAATTTTGTCCAGGTGTCGCCAGAATTTT TATGAGATTATAGTTGACTTTGATTGGTATGTGTCACTTCTTGGGGAAATATCAAGGATTCCACATTGCCAAAAGGGGGA AGAAATTGAGAATCAACTTATTGACATAGGTATGAGGGTTAAGGATGTTAGACTACCGCTTGTTCATGTTGGTCGTGACC TGCTGATTGATCCTGCGTTACTTGGGAATCCTTTCTTGCACAGGATATTATCTGCTGCTGCTTGGGTGTGTGGCGAGTAT gtgaaattttcaaagaaCCCAGTGGAACTTGTGGAAGCACTACTGCAGCCTCGCACTAGTCTCTTGCCTCCATCAGTCAG AACTGTTTACATGCAATCTgcttttaaaatcttaatattttgcCTACATTTTTACCTCTTACAAAGGGGATGTATTGCTG ATGATAAGGCGTCAGAAGTTATGGATTTGGCATCCCAAAGGGAATGCTCAGGAATGTCTGATTTGGCAACACACAAAGCA TCTGCCTGTTATGAACAGGAGGAAGGATTCAATCCAAGGGATTCGAATAGATCATATGAAGATCTTTCTATTATAGATGG TGGAGATGATCAAACAACTTCTTCTCCTGGGAAAAGTCTCACACATGAATCTTTTTCTAACCTGTTAACCTTAATTGAAT TGGCCTTGAATCCACTATCTAGAAATTATGATGTTGAAGTACAGGAGCGAGCACGGAATATACTGGGATTTGTTGAATTG ATAAAGCAACAAATATCCGATTGTTTCTTCCCCAAGGACGTGAATTTGAAGAAGGAAGATGTGAAAGTATTCAAATTTGT TGAGTTGGTGTATGATGCTTTCGCGGAGGAGCTTGGTCCAGTGTCTGTAAATGCTCAAGAGAGAGTTCCTGTACCAGATG GGTTAATGCTTAAGGAGAATCTTTCGGACTTGGAAGCAATTTGTGGAGATGTACAACTACCTTCATCAAGTTCGTTTTCT CTGGGAAGTCCTTATGGGGAAGATGTTGGTGCTTCTCCCATTACCCAAAGCAAAGAAGAGTCAGAACCATCAAGTGAGTC CACTTCATTGCTTGCTGAACATCGTAAGCGACATGGATTATATTATCTTCCTtcagagaaaaatgaaatcttAGCAAATG ATTATCCACCGGCCAATGACCTTAAATCCAGTATTGACACCCATGATGATGCTCAAGATCTAGTTAAGCTTGCTGACCAA TCACTTGTATCAAAGAGAAAGTCAAGCCTTGCAAAGCCTCGGCCGGTGGTGGTGAAGTTGGATGAGGGAGATGTACCCCT AACTGCCAAGAAACCAGATAGACAAGATGGTTTACTTTCTGGTGCTGTTCGAGATATTCTTTTAGCTAATCCATCTGATG AGACATCTAGTAATAGAAAAGGGAAGGAGAAACAGAATGTTGATCCTCTTGAATCGAGAGAAATATTGGGTGGAGAAAAG CCTGACCTTGGAAATCCAAGTTCTAGAAGAAGCAAACACCGGAGCCATGGTAAAGAGAAAGGCACGAAAAGTGTAGAGAA GAAGAATGCCGATGAAAATGATGATCatggagagaaagaaaagcatAAGAGTAGACATCGCCATGGCAGGCATAAAACTC GACAAAGAGCTGATGCGCCAACCTTAACTGTGGTCACACAAACACCAGTAATTCCTGATTTCCTTCTATAGCATTGAATT TATGTTTCAATGCTTCTCTTGTGGCTCCTGAGAACTTGGTTGATGTGACCACACTGTAATCTGCCACCTTGACTGCTAAG GTTAgtgtttttttcttatagatTTGGtacattatttttggttaCATTTTTTGGTTTCTTGGATAAACATCTAAACTTTG GGATTTGTTTTACATGTTACACATTGTGAAAAAGATTTAGAACCTGAATTGTAGTCTGTAGAAATTGAGATTGTCAGTTG GAAAAAGAAgggatttttttgttttcttcttcaaaaagGGAAAGAACTATAGTGCCTGAAATCAACCATTTGAAT
Product
AP-3 complex subunit delta
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237643.1
JCDBP29710
ID
JCDBP29710
Parent
JCDBR33779
Name
XP_012093033.1
Scaffold
NW_012130064.1
CDS
906355-909219
Strand:
+
Sequence
MASPSLMDTLFQRTLDDIIKGLRHQQTGESAFISKVMEEIRREIKSTDLHTKSIALHKLTYLNSIHFIDISWAAFHAIEC ISSPNFSHKKIGYLAISQSFNESTPVILLITNQLRKDLRSNNEFEVSLALECLSTIGTVDLCRDLTPEVFTLMSSSKLLV RKKALGVILRVFGKYPDAVRVCFKRLVECLDGTDQQIASAVIGVFCELASKDPRSYLPLAPEFYRVLVDSRNNWVLIKVL KIFAKLAPLEPRLAKRVVEPICDIMRRTGAKSLMFECIRTVATSFTDYESAVELAVAKNGEFLTDDDPNLKYLGLHVLSI IAPKHLWAVLQNKEVVIMSLSDADPNIKLESLRLVMAMVSESNVVEFCRVLVNYSLKSDPEFCNEILGSILSRCRQNFYE IIVDFDWYVSLLGEISRIPHCQKGEEIENQLIDIGMRVKDVRLPLVHVGRDLLIDPALLGNPFLHRILSAAAWVCGEYVK FSKNPVELVEALLQPRTSLLPPSVRTVYMQSAFKILIFCLHFYLLQRGCIADDKASEVMDLASQRECSGMSDLATHKASA CYEQEEGFNPRDSNRSYEDLSIIDGGDDQTTSSPGKSLTHESFSNLLTLIELALNPLSRNYDVEVQERARNILGFVELIK QQISDCFFPKDVNLKKEDVKVFKFVELVYDAFAEELGPVSVNAQERVPVPDGLMLKENLSDLEAICGDVQLPSSSSFSLG SPYGEDVGASPITQSKEESEPSSESTSLLAEHRKRHGLYYLPSEKNEILANDYPPANDLKSSIDTHDDAQDLVKLADQSL VSKRKSSLAKPRPVVVKLDEGDVPLTAKKPDRQDGLLSGAVRDILLANPSDETSSNRKGKEKQNVDPLESREILGGEKPD LGNPSSRRSKHRSHGKEKGTKSVEKKNADENDDHGEKEKHKSRHRHGRHKTRQRADAPTLTVVTQTPVIPDFLL
Product
AP-3 complex subunit delta
Source
Gnomon
Link
XP_012093033.1
InterProScan
IPR002553 Clathrin/coatomer adaptor, adaptin-like, N-terminal
IPR011989 Armadillo-like helical
IPR016024 Armadillo-type fold
Pfam
PF01602.16 Adaptin_N Family