Detail information of JCDBG25292

JCDBG25292
ID
JCDBG25292
Name
LOC105650700
Type
protein_coding
Scaffold
NW_012130064.1
Start
912346
End
914973
Strand
+
Link
Genbank id:105650700 | Jatropha Genome Database ID:Jcr4S05943.60
Molecular function
GO:0008375 | acetylglucosaminyltransferase activity
Cellular component
GO:0016020 | membrane
Biological process
KEGG
Source
Gnomon
TF
Description
hypothetical
Sequence
GGAAGCTCAAGCTTCTTGAACCTATACAAGAATCTCTCTCTCTACCTATAAAACGCCATTAATACCAAAAACTTAATACT AATATTTCAATTCCATCAGAAAATAAACGTTACTAATTGCACAGTCAGAAAGACCAAGACCTTCCATCTCTATCTCTCCT CTCTAATAACCACCATGAAGAATATAGACCATCAAACCAAGCTCATCAAGGGTGGCCAACTGCATcttcattacttattt atcTATTTCCTTGCTTTGGGTTGCAGTTTGGGCTTTGTTCTAACTGTtagtttttatctcaaaaACATTTCTTTCAACTG ccaattcaatcaaatctCAATCGAGAGCCAAATAACCATTTCGCCTCCGCCACCGACGATTTCACTTTTCTTACCAATTT CAAATAAAGCCACAGCTGGTATTGTACCTGAAGATGAAACAGTAAGTCTTACCGGGcttatttcaaatcaaacgATACCT CGTACTGACTATGTCTTGCATAATATGGCAGATAAAGAGCTGCTATGGAGAGCATCAATGGTGGCTCGTGTTAGTGAATT TCCATTTAAACTCACACCAAAGGTTGCGTTCTTGTTCTTGACAAAAGGATCTTTGCCTCTGGCTCCTCTGTGGGAATTGT TCTTTAAAGGGCATGAAGGGctttattctatttatgtGCATTACAGTCCATCCTTCAATGGAACAGTGCCTGTAGACTCC GTGTTTTATGGCAGGAGGATCCCAAGCAAGGTTGgtcaatttatttctttttcttcttcttttttgcttttcattgATAA TGCATTAAGACAACGAAAGTATAACTCGTTTGGAAACAGAACCAATAtcatggttttctttttcaaaatttttatcaatt atatgcaacattttaatataaaacaatacaaaattaaaaataaaaattggatacTATAAACTCAGACTTTATATAAGAAC AAGTTTATTAGTCattagattataaaattataagttaatgatataaaatacAGTTTATAGcatccttaaaaataaatgcc taattttctatttatttaataaaataaatgttctTCAAAGGCGTAGTTTAGTagaattttagttttcttctACAGGGATG GAGCCataagttcattattttagtGGGCAGAATTCAAAAATTCCATTGTTTCAGAGGATCCCTTGCCCCTCTCTCCTCTG CcattgttttttaataaatgactCACCAAAATTGATGAGAAATTTTGGAAATGAAACTTCATTTctcacattttaattta aatcaagtGAATAACAACTAATTAGGTGTAATTTAGTTGGCATGAGTAAAACTATTAATTCCACATTTCCATGTATTGCC ATTATTTAAGttttcatttctcaaaatttaattttaaaaaaatgaataacaacTAATTAGGTGTATTTTAGTTGGCATAA GTAAAgctattaatttcatatttctatatattgCCATGTATTTAAGTTTTCATTTctcacattttaattttttttaaaaa gtgaatAACAACTAATTAggtatatatttcttttttggtaaTAACTAAATAGGTATAGTTTAGTTGGCATAAATAAAgct aataatttcatatttccaTATATTACCATGTATTAAAGTTTTCTAACGGGAAATTCAGAATTTccttagataaaatttta cacTGTATTCAATATATTTAGTTGTTATTTCAATCAAATGGTATCACAATTAGCAATTATATGGAATTAGAACTCCAAAA TCCCAAGAAACGTACCATAAAAAATCACTCTAGATTTCCCAAGGATGGTTCTTACAGTAGCTGAGAAGTTTATTGGATTC TTTAGGGCCCAAACTTTTCTCTTACAGTAGCTAATGGTTCTTACAGTAGCTAGAACACTAGTTAATGCTATTGCTTCACA AATGCAGGAGACACGATGGGGGGAATTTACAATAGTGGAAGCTGAGCGCCGCCTATTAGCCAGTGCACTACTTGATTTCT CCAACCAATATTTCATTCTCCTTTCGGAATCTTGCATTCCTCTCTTCAACTTCTCCACAATCTACAATTATTTAATGGGT TCAGAAAAATCTTTTGTACAATCTTTTGATCTACGAGGTCCAGACGGTCGCTATCGATATAATCCAAGAATGAGCCCCAC AATTATGCTCGACCAGTGGCGAAAAGGTTCTCAGTGGTTTCAAATGAAGCGTAACATCGCCATTGAAGTAGTGTCTGACC GGAAATATTTTCCGGTCTTCCAGAGATTTTGCAAGGGTTATTGTTATGCTGACGAACACTATTTGCCAACATTTGTTGGC ATCAAGTTTTTGAAGAAGACTTCAAACAGGACCTTGACGTGGATCGACTGGCCAAAACGTGGGCCGCATCCAAGTCATTA TGGGAGAATGGATGTTACTGTAAATTTCTTGGAGAGTTTAAGGAATAAGGGCCCATGTGATTACAATGGGAAGGAGAACA GTATTTGCTTCTTGTTTGCAAGAAAGTTCGTGCCTAATGCTTTGCCTAGGCTTCTGAGATTTGCTCCTAAGTTGATGAAA TTTTAGTTGACCTCCCATGTGTTAGTGTTAATCTTTGttggataataaattttgggGCACAACAATAT
Gene structure

JCDB Genes gff download

JCDBG25292 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG25292's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG25292JCDBG20169co-exp0.646937
JCDBG25292JCDBG09527co-exp0.638251
JCDBG25292JCDBG03208co-exp0.627357
JCDBG25292JCDBG02295co-exp0.626267
JCDBG25292JCDBG01615co-exp0.624304
JCDBG25292JCDBG03728co-exp0.623845
JCDBG25292JCDBG16907co-exp0.620073
JCDBG25292JCDBG16753co-exp0.617609
JCDBG25292JCDBG12719co-exp0.614178
JCDBG25292JCDBG06621co-exp0.611567
JCDBG20169JCDBG09527co-exp0.732487
JCDBG20169JCDBG03208co-exp0.736528
JCDBG20169JCDBG02295co-exp0.757203
JCDBG20169JCDBG01615co-exp0.758921
JCDBG20169JCDBG03728co-exp0.656202
JCDBG20169JCDBG16907co-exp0.763541
JCDBG20169JCDBG12719co-exp0.731307
JCDBG20169JCDBG06621co-exp0.701824
JCDBG09527JCDBG03208co-exp0.692619
JCDBG09527JCDBG02295co-exp0.768084
JCDBG09527JCDBG01615co-exp0.706404
JCDBG09527JCDBG03728co-exp0.723892
JCDBG09527JCDBG16907co-exp0.750786
JCDBG09527JCDBG16753co-exp0.617785
JCDBG09527JCDBG12719co-exp0.707647
JCDBG09527JCDBG06621co-exp0.714445
JCDBG03208JCDBG02295co-exp0.732716
JCDBG03208JCDBG01615co-exp0.702642
JCDBG03208JCDBG03728co-exp0.69061
JCDBG03208JCDBG16907co-exp0.758214
JCDBG03208JCDBG12719co-exp0.748485
JCDBG03208JCDBG06621co-exp0.737119
JCDBG02295JCDBG01615co-exp0.761027
JCDBG02295JCDBG03728co-exp0.726724
JCDBG02295JCDBG16907co-exp0.817877
JCDBG02295JCDBG12719co-exp0.773032
JCDBG02295JCDBG06621co-exp0.767207
JCDBG01615JCDBG03728co-exp0.696886
JCDBG01615JCDBG16907co-exp0.855537
JCDBG01615JCDBG16753co-exp0.641044
JCDBG01615JCDBG12719co-exp0.80594
JCDBG01615JCDBG06621co-exp0.756693
JCDBG03728JCDBG16907co-exp0.712254
JCDBG03728JCDBG12719co-exp0.785113
JCDBG03728JCDBG06621co-exp0.759608
JCDBG16907JCDBG16753co-exp0.678614
JCDBG16907JCDBG12719co-exp0.784671
JCDBG16907JCDBG06621co-exp0.807469
JCDBG16753JCDBG06621co-exp0.644569
JCDBG12719JCDBG06621co-exp0.760528
PPI network
node1node2type
JCDBR33780
ID
JCDBR33780
Name
XM_012237644.1
Type
Scaffold
NW_012130064.1
Start
912346
End
914973
Strand
+
Exon
912346-913096,914274-914973
Sequence
GGAAGCTCAAGCTTCTTGAACCTATACAAGAATCTCTCTCTCTACCTATAAAACGCCATTAATACCAAAAACTTAATACT AATATTTCAATTCCATCAGAAAATAAACGTTACTAATTGCACAGTCAGAAAGACCAAGACCTTCCATCTCTATCTCTCCT CTCTAATAACCACCATGAAGAATATAGACCATCAAACCAAGCTCATCAAGGGTGGCCAACTGCATcttcattacttattt atcTATTTCCTTGCTTTGGGTTGCAGTTTGGGCTTTGTTCTAACTGTtagtttttatctcaaaaACATTTCTTTCAACTG ccaattcaatcaaatctCAATCGAGAGCCAAATAACCATTTCGCCTCCGCCACCGACGATTTCACTTTTCTTACCAATTT CAAATAAAGCCACAGCTGGTATTGTACCTGAAGATGAAACAGTAAGTCTTACCGGGcttatttcaaatcaaacgATACCT CGTACTGACTATGTCTTGCATAATATGGCAGATAAAGAGCTGCTATGGAGAGCATCAATGGTGGCTCGTGTTAGTGAATT TCCATTTAAACTCACACCAAAGGTTGCGTTCTTGTTCTTGACAAAAGGATCTTTGCCTCTGGCTCCTCTGTGGGAATTGT TCTTTAAAGGGCATGAAGGGctttattctatttatgtGCATTACAGTCCATCCTTCAATGGAACAGTGCCTGTAGACTCC GTGTTTTATGGCAGGAGGATCCCAAGCAAGGTTGgtcaatttatttctttttcttcttcttttttgcttttcattgATAA TGCATTAAGACAACGAAAGTATAACTCGTTTGGAAACAGAACCAATAtcatggttttctttttcaaaatttttatcaatt atatgcaacattttaatataaaacaatacaaaattaaaaataaaaattggatacTATAAACTCAGACTTTATATAAGAAC AAGTTTATTAGTCattagattataaaattataagttaatgatataaaatacAGTTTATAGcatccttaaaaataaatgcc taattttctatttatttaataaaataaatgttctTCAAAGGCGTAGTTTAGTagaattttagttttcttctACAGGGATG GAGCCataagttcattattttagtGGGCAGAATTCAAAAATTCCATTGTTTCAGAGGATCCCTTGCCCCTCTCTCCTCTG CcattgttttttaataaatgactCACCAAAATTGATGAGAAATTTTGGAAATGAAACTTCATTTctcacattttaattta aatcaagtGAATAACAACTAATTAGGTGTAATTTAGTTGGCATGAGTAAAACTATTAATTCCACATTTCCATGTATTGCC ATTATTTAAGttttcatttctcaaaatttaattttaaaaaaatgaataacaacTAATTAGGTGTATTTTAGTTGGCATAA GTAAAgctattaatttcatatttctatatattgCCATGTATTTAAGTTTTCATTTctcacattttaattttttttaaaaa gtgaatAACAACTAATTAggtatatatttcttttttggtaaTAACTAAATAGGTATAGTTTAGTTGGCATAAATAAAgct aataatttcatatttccaTATATTACCATGTATTAAAGTTTTCTAACGGGAAATTCAGAATTTccttagataaaatttta cacTGTATTCAATATATTTAGTTGTTATTTCAATCAAATGGTATCACAATTAGCAATTATATGGAATTAGAACTCCAAAA TCCCAAGAAACGTACCATAAAAAATCACTCTAGATTTCCCAAGGATGGTTCTTACAGTAGCTGAGAAGTTTATTGGATTC TTTAGGGCCCAAACTTTTCTCTTACAGTAGCTAATGGTTCTTACAGTAGCTAGAACACTAGTTAATGCTATTGCTTCACA AATGCAGGAGACACGATGGGGGGAATTTACAATAGTGGAAGCTGAGCGCCGCCTATTAGCCAGTGCACTACTTGATTTCT CCAACCAATATTTCATTCTCCTTTCGGAATCTTGCATTCCTCTCTTCAACTTCTCCACAATCTACAATTATTTAATGGGT TCAGAAAAATCTTTTGTACAATCTTTTGATCTACGAGGTCCAGACGGTCGCTATCGATATAATCCAAGAATGAGCCCCAC AATTATGCTCGACCAGTGGCGAAAAGGTTCTCAGTGGTTTCAAATGAAGCGTAACATCGCCATTGAAGTAGTGTCTGACC GGAAATATTTTCCGGTCTTCCAGAGATTTTGCAAGGGTTATTGTTATGCTGACGAACACTATTTGCCAACATTTGTTGGC ATCAAGTTTTTGAAGAAGACTTCAAACAGGACCTTGACGTGGATCGACTGGCCAAAACGTGGGCCGCATCCAAGTCATTA TGGGAGAATGGATGTTACTGTAAATTTCTTGGAGAGTTTAAGGAATAAGGGCCCATGTGATTACAATGGGAAGGAGAACA GTATTTGCTTCTTGTTTGCAAGAAAGTTCGTGCCTAATGCTTTGCCTAGGCTTCTGAGATTTGCTCCTAAGTTGATGAAA TTTTAGTTGACCTCCCATGTGTTAGTGTTAATCTTTGttggataataaattttgggGCACAACAATAT
Product
uncharacterized LOC105650700
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237644.1
JCDBP29711
ID
JCDBP29711
Parent
JCDBR33780
Name
XP_012093034.1
Scaffold
NW_012130064.1
CDS
912521-913096,914274-914912
Strand:
+
Sequence
MKNIDHQTKLIKGGQLHLHYLFIYFLALGCSLGFVLTVSFYLKNISFNCQFNQISIESQITISPPPPTISLFLPISNKAT AGIVPEDETVSLTGLISNQTIPRTDYVLHNMADKELLWRASMVARVSEFPFKLTPKVAFLFLTKGSLPLAPLWELFFKGH EGLYSIYVHYSPSFNGTVPVDSVFYGRRIPSKETRWGEFTIVEAERRLLASALLDFSNQYFILLSESCIPLFNFSTIYNY LMGSEKSFVQSFDLRGPDGRYRYNPRMSPTIMLDQWRKGSQWFQMKRNIAIEVVSDRKYFPVFQRFCKGYCYADEHYLPT FVGIKFLKKTSNRTLTWIDWPKRGPHPSHYGRMDVTVNFLESLRNKGPCDYNGKENSICFLFARKFVPNALPRLLRFAPK LMKF
Product
uncharacterized protein LOC105650700
Source
Gnomon
Link
XP_012093034.1
InterProScan
IPR003406 Glycosyl transferase, family 14
Pfam
PF02485.17 Branch Family