Detail information of JCDBG25293

JCDBG25293
ID
JCDBG25293
Name
LOC105650728
Type
protein_coding
Scaffold
NW_012130064.1
Start
918023
End
922715
Strand
+
Link
Genbank id:105650728 | Jatropha Genome Database ID:Jcr4S05943.40
Molecular function
GO:0005516 | calmodulin binding
Cellular component
Biological process
GO:0006950 | response to stress
KEGG
Source
Gnomon
TF
Description
protein
Sequence
TTCATTATTACCATCATCTCTCCCGAGCTCTAAAAATGGCTGCCAAACGTTTTTTTGATGAATCGGGTTCTGACCCAGAT CAACCAACCGACAAGCGGTTACGAACTAGACCTTCTTTTGCTTCGTATGTCTTTAACCTTCTAGCTTAATTACAAATCTC TTTTtggatctctctctctctctctctctgtgaTTTCTGGAtctctttgattttgagtCTTGGAGTCTCCGCTTTTTCTT ATttgcatttcttgaatttttcttttctttggtaCTGTCCAAAGTTAGAAAATGAattggtttttctttctttctttcaa aagaaaaaagacaaGAAAGTAAAGGAGATTGCACTAAATTGGAAAGAAATAAAgtctcattttctttgtttctttcttta tttatctttGCAGAGTAATTGGAGAAGCGGTTATGGTGAATTCTTTACAAAAATTCTGTTTGGCCTTAGAGCCAATGATT AGGAGAGTGGTAAGTTAATCTCTTATGCATATATCAttaattcttatatatttatacaagaAAGTATTAGTTGATCACAT ACAAACATACATTTAAAGTAGGTCCGCAATTTGTTATGTATATGaaccttattttctttttaaattactgtaattaaact aattatgtAAACCCTAAAGATTATAATAGTATGTTCATCTTAATTCATCAAGGATTTGTTCATGTTCTATGCATGTTTGT AGGTGAATGAAGAAGTGGAGAGTAGTCTAAAACGGTTGTCATCCTGCAAATTCACTCGATCTCCTTCACTGCGAATCCAA GCACCGGAGCCTTCACCATCACGCCTACAATTAATCTTTGGGAAAAAGCTTCTAACTCCAATATTTACAGGAAGCAAAAT CGTTCACATAGATGGCACTTCCCTTCAAATACTTCTAGTAGACAAAGATGGTGGTCGAATGATTCCTACACCTCTCCCTT ACCCAGTCAAAATAGAAATCGTTGTTCTTGACGGCGATTTCCCTTTGGAGGATAAAAGCACTTGGACCAGTGAAGAATTT gacaacaaaattttaaaggaGAGAACAGGCAAAAGGCCTTTACTGGCCGGAGATTGCTTAACGGTCACATTAAGAGATGC AACTGCACCAATTGGAGAAATTGAGTTTACTGATAATTCAAGTTGGATTAGAGGCAGGAAGTTCAGGCTGGGTGCAAGAA TAGTTCAAGGTAGCTCTCATGGTGTTCGAATTCGCGAAGCGATGACTGAAGCTTTCGTTGTGAAGGATCATCGCGGAGAG TGTAAGTTTCTTCTACCTGATTACTTATATTTATCTGCTTATTTCTTTACTAAATGCATATATCCTATACATACACACTG CATACCGAATTCATCTTATTGTTTGTATGAATATCTCTATTTAGTTATGCACTAAAAATCTTATGTGCACATAAAATCTC AGATTTGCaccaataaaatttcagatttgcaCCAATCAAAGTTTGCAccaataaaaatcttaaataaaataaaagatgat catatatatagacacacaCACATTGGCTTTGTTGTTATTTCTTTGTGATATTTCATGACTTAGTTCACTGTGTATAGATT TTCCCCTTAGACAATATGCATATTACATTTCTTTGCTTGCCAATTAGAGTAATATTTTGGTTTCATGCTTGCTAGACACT TAACAATTATTGggaaatcaataaaaatatacaatgaTCATCAAATGGCtgcatattatatatattatgatctATTTGct tctttaaaattattcctGCGTCTCTAATTAATATGGGTTGGTGATGATGTAcgcatatataaatttttgtctCTGCCAAC GATGGATtgcttaaataaaatagagaatcTAAGTCTtgaatcaaacttttttagTGATgaacaaatcaaatttattatta attttctgcaACAACTTGGGATAAATCATATCTATATAAGTTGCTACTTGCTgacttttcaattattttatctgtTCATC AAATTGCTAAAGCTTAGctaataattcatatatagGGTCCTACCCTAGCTGATTACTCTTGTtgatatatgaattatttg ataatcATTCTCGTTTCACTTGTTAATCATATTATAATCTCTAGGATCACTAATTTTTGCCATTAGTTCCCAatacatta tattaaaaatatataattccttttctttaaaaattttcaatgtatttttttttagaaaaagaactaaataattttttaaa aatttaatagaaaattactaTGTTCTTGCCTATGAATTGATTGTTGGTCTATCTTAGGAGATTAATAActtcaaatcttt cttttatatatatatatatatatataaaacttcAAATCTTAATATCCccctaaaaatttttgatttataattaaaaaaga taaaattctgattttgagtatttaattaaaagacaaagtacatcacaaaacaaaaagattgcATTCAGTGCATATATTAG GACACATCCTTTTCAtgctttaaattaaaataacatacACCAGCAACTTTTTATCAACAAAGAgccataaaatttatttt caacatcgaattatttatttaagtttcttaaataaaacaaGTACAAGTGTCCCCTACTGATACGATCTCAGGACCAGTAA CAACCAAGTCTCCGATAATGACAATTGCTATCAATGATGTAAGGTCAATAAATGGTAATTTTGGTCACAgaattgataat atttaattaatatcatcaCAAATTACTCCTAATAtatagtatattttaaaatttaaagatgaACTAGTAATAGTATTCTT TATCCATTCTAGTCAAATCccaatatttattcaattgggatgagataaattaattaactctttttttttttttttttttc aattgaccCCTGCTTCAATTAATATCATCACAAATTACTCCTAATAtatagtatattttaaaatttaaagatgaACTAGT AATAGTATTCTTTATCCATTCTAGTCAAATCccaatatttattcaattgggatgagataaattaattaactctttttttt ttttttttttgcaattgaCCCCTGCTTCTcttataaaattgtttttcagaACAtcctataaattaaaaataaagcttata ataatttagaaatataaaatatcaatgtTTATTACTATTTGAGTGAATGAATTCTTGGCATAATATATGCTttctaaact ttttaaaattcaaaatttttctcttaaatcttatttatatttttttaaatatgcatATTTGTTCTTCAAAACttctaaaa attcaattttcttccCTTGAGTTTTCATGTTAGCCTCCTAATGTTCAAAgtttaactatatattttacttGGGGTCCCCC AATGTTCAAAGTCTAGCTCAACCTCTCAATATTAGTATATATGTCACATTTTTTCGAACAATATATATTAaccttttttt atatgtatatatataaacgtAGTGTATAAGAAGCATTACCCACCAATGTTGGAAGACGAAGTATGGCGTCTTGAAAAGAT AGGAAAAGATGGAGCTTTCCACAAAAAGCTAAATTCTGATGGCATTAACACTGTCCAAGACTTCTTGAAATTGTCCATTG TCGACTCGCAAAAGCTCAGGAGGGTAAGCAAATTAATTTccattctttcaatttctatacAACAGGTAACTCTCcctaaa ttgataaaaatactTGTGATCAAGAAGACTGAAACTCGAGACCTCTAACTCTTcacataaatgaaaagatcAACCAAATT ACACCTGATTTACTACATTTTCCAAAATTCAagtactaaaatattataattatgaattttgtaTGTTTTGAACAGATTTT AGGTGCTGGAATGTCTGAGAAAATATGGGAAGCGACAATAAAGCATGCAAGGACATGTGAGTTGGGAAACAAACATTACA TTTTCCGGGGACAAAATTGTACTGTTACATTGAACCCAATTTGTCAAGTTGTTAATGCCATTATTGATGGTCATACCTAC TCTACTAGGGATCTTCCAACCATTAACAGGGTATGTGTCCTTATTTTACACAACTCAAATTTCTAAGTCCTTGTTCATTT TGTTCATCCATTGATTTTAGGTTCATCTTGCTTTATGTAGGGTTACATTGCAAGTTTGGTGAGACAAGCATATGCAAATT GGAACTCATTACAAGAGATAGTTGGAGTATCAAGTGAAATGGCTTTGCTGACACTCGGTAATTAATATGTCTATAATGTA ACGGATTATAAATGCATCTCATatctatatttaaatttatccataattttcaatttataaaaaaaaatcagagaTTGAGC GAATCgagcttttaaaaatttaatattctttagATCGAGCAATCAAAAAAGTCATTTTTATCCGAAAATTAAGTAACTAT TATTAAcaagattaattactttaaacTTGATATAGGTGAGCAAGCAGTGAATGAGTACCCGAGTCACCATCTTCAGGCCA TGATAAAACCAATTCACGAAATTGGGTATTCAAGTGATGATAGATATACTGACATGGGGACCCAACTTAACACTAGTAGC ACTGCGAATATGATGGGATACAACAACTGGCATAATATGGCTGCACCAATTAGTCCGACCATCGGTTATAGCATATCGGA GTCGTCGTCGGACGGTGAACTGACACCTCGGTCCTACATTAATCGCAACTGAT
Gene structure

JCDB Genes gff download

JCDBG25293 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBG25293's gene network (protein-protein interaction & gene co-expression among this gene and its Top10 neighbors)   

Node color:
Pumpkin: this gene;
Macaroni And Cheese : co-expression gene;
Forest Green :protein-interacting gene ;
Edge color:
Pelorous: co-expression;
Turquoise Blue HueBlue : protein protein interaction;

co-expression network
node1node2typescc
JCDBG25293JCDBG11152co-exp0.744242
JCDBG25293JCDBG03541co-exp0.738761
JCDBG25293JCDBG22747co-exp0.723447
JCDBG25293JCDBG07381co-exp0.720827
JCDBG25293JCDBG21961co-exp0.72022
JCDBG25293JCDBG05726co-exp0.718738
JCDBG25293JCDBG23852co-exp0.713454
JCDBG25293JCDBG15729co-exp0.707663
JCDBG25293JCDBG13337co-exp0.706298
JCDBG25293JCDBG15885co-exp0.705849
JCDBG11152JCDBG03541co-exp0.639819
JCDBG11152JCDBG07381co-exp0.647925
JCDBG11152JCDBG05726co-exp0.608147
JCDBG11152JCDBG23852co-exp0.62946
JCDBG11152JCDBG15729co-exp0.621742
JCDBG03541JCDBG22747co-exp0.612856
JCDBG03541JCDBG07381co-exp0.693755
JCDBG03541JCDBG21961co-exp0.619375
JCDBG03541JCDBG05726co-exp0.640969
JCDBG03541JCDBG23852co-exp0.729905
JCDBG03541JCDBG15729co-exp0.758382
JCDBG03541JCDBG13337co-exp0.741662
JCDBG03541JCDBG15885co-exp0.651713
JCDBG22747JCDBG07381co-exp0.745865
JCDBG22747JCDBG21961co-exp0.712249
JCDBG22747JCDBG05726co-exp0.726924
JCDBG22747JCDBG23852co-exp0.70057
JCDBG22747JCDBG15885co-exp0.861671
JCDBG07381JCDBG21961co-exp0.764591
JCDBG07381JCDBG05726co-exp0.795778
JCDBG07381JCDBG23852co-exp0.829729
JCDBG07381JCDBG15729co-exp0.710034
JCDBG07381JCDBG13337co-exp0.636412
JCDBG07381JCDBG15885co-exp0.754642
JCDBG21961JCDBG05726co-exp0.768959
JCDBG21961JCDBG23852co-exp0.81336
JCDBG21961JCDBG15729co-exp0.682495
JCDBG21961JCDBG13337co-exp0.680353
JCDBG21961JCDBG15885co-exp0.820372
JCDBG05726JCDBG23852co-exp0.849425
JCDBG05726JCDBG15729co-exp0.619567
JCDBG05726JCDBG15885co-exp0.757091
JCDBG23852JCDBG15729co-exp0.735962
JCDBG23852JCDBG13337co-exp0.713177
JCDBG23852JCDBG15885co-exp0.754694
JCDBG15729JCDBG13337co-exp0.733325
JCDBG15729JCDBG15885co-exp0.668474
JCDBG13337JCDBG15885co-exp0.607543
PPI network
node1node2type
JCDBR33781
ID
JCDBR33781
Name
XM_012237669.1
Type
Scaffold
NW_012130064.1
Start
918023
End
922715
Strand
+
Exon
918023-918147,918437-918512,918746-919304,921486-921646,921859-922053,922144-922240,922459-922715
Sequence
TTCATTATTACCATCATCTCTCCCGAGCTCTAAAAATGGCTGCCAAACGTTTTTTTGATGAATCGGGTTCTGACCCAGAT CAACCAACCGACAAGCGGTTACGAACTAGACCTTCTTTTGCTTCGTATGTCTTTAACCTTCTAGCTTAATTACAAATCTC TTTTtggatctctctctctctctctctctgtgaTTTCTGGAtctctttgattttgagtCTTGGAGTCTCCGCTTTTTCTT ATttgcatttcttgaatttttcttttctttggtaCTGTCCAAAGTTAGAAAATGAattggtttttctttctttctttcaa aagaaaaaagacaaGAAAGTAAAGGAGATTGCACTAAATTGGAAAGAAATAAAgtctcattttctttgtttctttcttta tttatctttGCAGAGTAATTGGAGAAGCGGTTATGGTGAATTCTTTACAAAAATTCTGTTTGGCCTTAGAGCCAATGATT AGGAGAGTGGTAAGTTAATCTCTTATGCATATATCAttaattcttatatatttatacaagaAAGTATTAGTTGATCACAT ACAAACATACATTTAAAGTAGGTCCGCAATTTGTTATGTATATGaaccttattttctttttaaattactgtaattaaact aattatgtAAACCCTAAAGATTATAATAGTATGTTCATCTTAATTCATCAAGGATTTGTTCATGTTCTATGCATGTTTGT AGGTGAATGAAGAAGTGGAGAGTAGTCTAAAACGGTTGTCATCCTGCAAATTCACTCGATCTCCTTCACTGCGAATCCAA GCACCGGAGCCTTCACCATCACGCCTACAATTAATCTTTGGGAAAAAGCTTCTAACTCCAATATTTACAGGAAGCAAAAT CGTTCACATAGATGGCACTTCCCTTCAAATACTTCTAGTAGACAAAGATGGTGGTCGAATGATTCCTACACCTCTCCCTT ACCCAGTCAAAATAGAAATCGTTGTTCTTGACGGCGATTTCCCTTTGGAGGATAAAAGCACTTGGACCAGTGAAGAATTT gacaacaaaattttaaaggaGAGAACAGGCAAAAGGCCTTTACTGGCCGGAGATTGCTTAACGGTCACATTAAGAGATGC AACTGCACCAATTGGAGAAATTGAGTTTACTGATAATTCAAGTTGGATTAGAGGCAGGAAGTTCAGGCTGGGTGCAAGAA TAGTTCAAGGTAGCTCTCATGGTGTTCGAATTCGCGAAGCGATGACTGAAGCTTTCGTTGTGAAGGATCATCGCGGAGAG TGTAAGTTTCTTCTACCTGATTACTTATATTTATCTGCTTATTTCTTTACTAAATGCATATATCCTATACATACACACTG CATACCGAATTCATCTTATTGTTTGTATGAATATCTCTATTTAGTTATGCACTAAAAATCTTATGTGCACATAAAATCTC AGATTTGCaccaataaaatttcagatttgcaCCAATCAAAGTTTGCAccaataaaaatcttaaataaaataaaagatgat catatatatagacacacaCACATTGGCTTTGTTGTTATTTCTTTGTGATATTTCATGACTTAGTTCACTGTGTATAGATT TTCCCCTTAGACAATATGCATATTACATTTCTTTGCTTGCCAATTAGAGTAATATTTTGGTTTCATGCTTGCTAGACACT TAACAATTATTGggaaatcaataaaaatatacaatgaTCATCAAATGGCtgcatattatatatattatgatctATTTGct tctttaaaattattcctGCGTCTCTAATTAATATGGGTTGGTGATGATGTAcgcatatataaatttttgtctCTGCCAAC GATGGATtgcttaaataaaatagagaatcTAAGTCTtgaatcaaacttttttagTGATgaacaaatcaaatttattatta attttctgcaACAACTTGGGATAAATCATATCTATATAAGTTGCTACTTGCTgacttttcaattattttatctgtTCATC AAATTGCTAAAGCTTAGctaataattcatatatagGGTCCTACCCTAGCTGATTACTCTTGTtgatatatgaattatttg ataatcATTCTCGTTTCACTTGTTAATCATATTATAATCTCTAGGATCACTAATTTTTGCCATTAGTTCCCAatacatta tattaaaaatatataattccttttctttaaaaattttcaatgtatttttttttagaaaaagaactaaataattttttaaa aatttaatagaaaattactaTGTTCTTGCCTATGAATTGATTGTTGGTCTATCTTAGGAGATTAATAActtcaaatcttt cttttatatatatatatatatatataaaacttcAAATCTTAATATCCccctaaaaatttttgatttataattaaaaaaga taaaattctgattttgagtatttaattaaaagacaaagtacatcacaaaacaaaaagattgcATTCAGTGCATATATTAG GACACATCCTTTTCAtgctttaaattaaaataacatacACCAGCAACTTTTTATCAACAAAGAgccataaaatttatttt caacatcgaattatttatttaagtttcttaaataaaacaaGTACAAGTGTCCCCTACTGATACGATCTCAGGACCAGTAA CAACCAAGTCTCCGATAATGACAATTGCTATCAATGATGTAAGGTCAATAAATGGTAATTTTGGTCACAgaattgataat atttaattaatatcatcaCAAATTACTCCTAATAtatagtatattttaaaatttaaagatgaACTAGTAATAGTATTCTT TATCCATTCTAGTCAAATCccaatatttattcaattgggatgagataaattaattaactctttttttttttttttttttc aattgaccCCTGCTTCAATTAATATCATCACAAATTACTCCTAATAtatagtatattttaaaatttaaagatgaACTAGT AATAGTATTCTTTATCCATTCTAGTCAAATCccaatatttattcaattgggatgagataaattaattaactctttttttt ttttttttttgcaattgaCCCCTGCTTCTcttataaaattgtttttcagaACAtcctataaattaaaaataaagcttata ataatttagaaatataaaatatcaatgtTTATTACTATTTGAGTGAATGAATTCTTGGCATAATATATGCTttctaaact ttttaaaattcaaaatttttctcttaaatcttatttatatttttttaaatatgcatATTTGTTCTTCAAAACttctaaaa attcaattttcttccCTTGAGTTTTCATGTTAGCCTCCTAATGTTCAAAgtttaactatatattttacttGGGGTCCCCC AATGTTCAAAGTCTAGCTCAACCTCTCAATATTAGTATATATGTCACATTTTTTCGAACAATATATATTAaccttttttt atatgtatatatataaacgtAGTGTATAAGAAGCATTACCCACCAATGTTGGAAGACGAAGTATGGCGTCTTGAAAAGAT AGGAAAAGATGGAGCTTTCCACAAAAAGCTAAATTCTGATGGCATTAACACTGTCCAAGACTTCTTGAAATTGTCCATTG TCGACTCGCAAAAGCTCAGGAGGGTAAGCAAATTAATTTccattctttcaatttctatacAACAGGTAACTCTCcctaaa ttgataaaaatactTGTGATCAAGAAGACTGAAACTCGAGACCTCTAACTCTTcacataaatgaaaagatcAACCAAATT ACACCTGATTTACTACATTTTCCAAAATTCAagtactaaaatattataattatgaattttgtaTGTTTTGAACAGATTTT AGGTGCTGGAATGTCTGAGAAAATATGGGAAGCGACAATAAAGCATGCAAGGACATGTGAGTTGGGAAACAAACATTACA TTTTCCGGGGACAAAATTGTACTGTTACATTGAACCCAATTTGTCAAGTTGTTAATGCCATTATTGATGGTCATACCTAC TCTACTAGGGATCTTCCAACCATTAACAGGGTATGTGTCCTTATTTTACACAACTCAAATTTCTAAGTCCTTGTTCATTT TGTTCATCCATTGATTTTAGGTTCATCTTGCTTTATGTAGGGTTACATTGCAAGTTTGGTGAGACAAGCATATGCAAATT GGAACTCATTACAAGAGATAGTTGGAGTATCAAGTGAAATGGCTTTGCTGACACTCGGTAATTAATATGTCTATAATGTA ACGGATTATAAATGCATCTCATatctatatttaaatttatccataattttcaatttataaaaaaaaatcagagaTTGAGC GAATCgagcttttaaaaatttaatattctttagATCGAGCAATCAAAAAAGTCATTTTTATCCGAAAATTAAGTAACTAT TATTAAcaagattaattactttaaacTTGATATAGGTGAGCAAGCAGTGAATGAGTACCCGAGTCACCATCTTCAGGCCA TGATAAAACCAATTCACGAAATTGGGTATTCAAGTGATGATAGATATACTGACATGGGGACCCAACTTAACACTAGTAGC ACTGCGAATATGATGGGATACAACAACTGGCATAATATGGCTGCACCAATTAGTCCGACCATCGGTTATAGCATATCGGA GTCGTCGTCGGACGGTGAACTGACACCTCGGTCCTACATTAATCGCAACTGAT
Product
uncharacterized LOC105650728
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237669.1
JCDBP29712
ID
JCDBP29712
Parent
JCDBR33781
Name
XP_012093059.1
Scaffold
NW_012130064.1
CDS
918059-918147,918437-918512,918746-919304,921486-921646,921859-922053,922144-922240,922459-922715
Strand:
+
Sequence
MAAKRFFDESGSDPDQPTDKRLRTRPSFASVIGEAVMVNSLQKFCLALEPMIRRVVNEEVESSLKRLSSCKFTRSPSLRI QAPEPSPSRLQLIFGKKLLTPIFTGSKIVHIDGTSLQILLVDKDGGRMIPTPLPYPVKIEIVVLDGDFPLEDKSTWTSEE FDNKILKERTGKRPLLAGDCLTVTLRDATAPIGEIEFTDNSSWIRGRKFRLGARIVQGSSHGVRIREAMTEAFVVKDHRG ELYKKHYPPMLEDEVWRLEKIGKDGAFHKKLNSDGINTVQDFLKLSIVDSQKLRRILGAGMSEKIWEATIKHARTCELGN KHYIFRGQNCTVTLNPICQVVNAIIDGHTYSTRDLPTINRGYIASLVRQAYANWNSLQEIVGVSSEMALLTLGEQAVNEY PSHHLQAMIKPIHEIGYSSDDRYTDMGTQLNTSSTANMMGYNNWHNMAAPISPTIGYSISESSSDGELTPRSYINRN
Product
uncharacterized protein LOC105650728
Source
Gnomon
Link
XP_012093059.1
InterProScan
IPR012416 CALMODULIN-BINDING PROTEIN60
Pfam
PF07887.7 Calmodulin_bind Family