Detail information of JCDBG25294

JCDBG25294
ID
JCDBG25294
Name
LOC105650702
Type
protein_coding
Scaffold
NW_012130064.1
Start
925534
End
926587
Strand
+
Link
Genbank id:105650702
Molecular function
Cellular component
Biological process
KEGG
Source
Gnomon
TF
Description
LEAF
Sequence
CAAGAATATTATAGAATGAAAATCGTTAGATGGGACTTGTGGCAAGATTCTTGTCCTGACGGTGAAAATCTTGAAGATGT TGCTTTGGATAATCGTCTCTTTAGTTACACTTCAACTTTCAGAAATCTTACATTAATGTATAGATGTCCTATGGTGGATT CAATTAAGAAATGTAATTTTACATGTAATGAAAGTCTTACAGGTGTTTATAATTACTATGCGGATGAAGTTACCTGGGAA ACTCGAAAACCTGATCTTAAAAAGCATTGTCGAGCTCATTTGACTACTCCGGTGTTGCAGGCGGCTTTAGTTCAATTGTA TGATTCATCTAGGACGGTTGATGAAGTTGTTAGTGAAGGTTTTGAAGCTGAATATAACGTACATAGACATGCTTGTCTTA ACTGTCAGGACTCTGATGGGATTTGTGGTTCTAATTTAACCACACATGATTTTCTCTGTCTTTGTAAAGACCAACctaaa gaaaattcatcttCTCCAGGATCAAGAATTATCTCTGGTATGTATTCTCGTAACCTTATTATCTGTGGAATTATCAGAAT TGTCTCTTGTATAgtctttttcattttcgaaCTTGTAACTGAGTGAAAAATTACAGTTAGATTGTACAATCTTTAAGCTT ATTTGATGCAACTTACATTGTTTTGCAGGCCAAAAACCAAGACTAAAGAAGTCTCGAATAGGCATTATTGCTTTTGCCTT AGCTGGAATATTACTTTTCACTGtcattcttttctatttttggcgCCCCGGATGGATTATAGCATCAAATCCAACACTGA TTGTTCCCTTTCGGCAGGTGAGAACTAACAAGAATATTGAGAAAGTGATTAAACAGTTCATTCTCCAAAACAATATAGCT ATTCAGATGTAAAAAGAATGACAGGCTCGTTCAAGAATAAGTTAGGCCATGGAGGTTCTGGAAGTGTATACAGAGGAAGG CTGCAAGATGGTCGTCCTGTGGCGGTGAAGATCCTTAATGAAAATCTGAAAGGGAAACGGCAAGGGgaagaatttataaa tgaaattgttAGCA
Gene structure

JCDB Genes gff download

JCDBG25294 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR33782
ID
JCDBR33782
Name
XM_012237645.1
Type
Scaffold
NW_012130064.1
Start
925534
End
926587
Strand
+
Exon
925534-926587
Sequence
CAAGAATATTATAGAATGAAAATCGTTAGATGGGACTTGTGGCAAGATTCTTGTCCTGACGGTGAAAATCTTGAAGATGT TGCTTTGGATAATCGTCTCTTTAGTTACACTTCAACTTTCAGAAATCTTACATTAATGTATAGATGTCCTATGGTGGATT CAATTAAGAAATGTAATTTTACATGTAATGAAAGTCTTACAGGTGTTTATAATTACTATGCGGATGAAGTTACCTGGGAA ACTCGAAAACCTGATCTTAAAAAGCATTGTCGAGCTCATTTGACTACTCCGGTGTTGCAGGCGGCTTTAGTTCAATTGTA TGATTCATCTAGGACGGTTGATGAAGTTGTTAGTGAAGGTTTTGAAGCTGAATATAACGTACATAGACATGCTTGTCTTA ACTGTCAGGACTCTGATGGGATTTGTGGTTCTAATTTAACCACACATGATTTTCTCTGTCTTTGTAAAGACCAACctaaa gaaaattcatcttCTCCAGGATCAAGAATTATCTCTGGTATGTATTCTCGTAACCTTATTATCTGTGGAATTATCAGAAT TGTCTCTTGTATAgtctttttcattttcgaaCTTGTAACTGAGTGAAAAATTACAGTTAGATTGTACAATCTTTAAGCTT ATTTGATGCAACTTACATTGTTTTGCAGGCCAAAAACCAAGACTAAAGAAGTCTCGAATAGGCATTATTGCTTTTGCCTT AGCTGGAATATTACTTTTCACTGtcattcttttctatttttggcgCCCCGGATGGATTATAGCATCAAATCCAACACTGA TTGTTCCCTTTCGGCAGGTGAGAACTAACAAGAATATTGAGAAAGTGATTAAACAGTTCATTCTCCAAAACAATATAGCT ATTCAGATGTAAAAAGAATGACAGGCTCGTTCAAGAATAAGTTAGGCCATGGAGGTTCTGGAAGTGTATACAGAGGAAGG CTGCAAGATGGTCGTCCTGTGGCGGTGAAGATCCTTAATGAAAATCTGAAAGGGAAACGGCAAGGGgaagaatttataaa tgaaattgttAGCA
Product
uncharacterized protein At1g18380-like
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237645.1
JCDBP29713
ID
JCDBP29713
Parent
JCDBR33782
Name
XP_012093035.1
Scaffold
NW_012130064.1
CDS
925550-926140
Strand:
+
Sequence
MKIVRWDLWQDSCPDGENLEDVALDNRLFSYTSTFRNLTLMYRCPMVDSIKKCNFTCNESLTGVYNYYADEVTWETRKPD LKKHCRAHLTTPVLQAALVQLYDSSRTVDEVVSEGFEAEYNVHRHACLNCQDSDGICGSNLTTHDFLCLCKDQPKENSSS PGSRIISGMYSRNLIICGIIRIVSCIVFFIFELVTE
Product
uncharacterized protein At1g18380-like
Source
Gnomon
Link
XP_012093035.1
InterProScan
IPR032872 Wall-associated receptor kinase, C-terminal
Pfam
PF14380.2 WAK_assoc Domain