Detail information of JCDBG25295

JCDBG25295
ID
JCDBG25295
Name
LOC105650730
Type
protein_coding
Scaffold
NW_012130064.1
Start
926432
End
927327
Strand
+
Link
Genbank id:105650730
Molecular function
GO:0005524 | ATP binding
GO:0004672 | protein kinase activity
Cellular component
Biological process
GO:0006468 | protein phosphorylation
KEGG
Source
Gnomon
TF
Description
LEAF
Sequence
TGACAGGCTCGTTCAAGAATAAGTTAGGCCATGGAGGTTCTGGAAGTGTATACAGAGGAAGGCTGCAAGATGGTCGTCCT GTGGCGGTGAAGATCCTTAATGAAAATCTGAAAGGGAAACGGCAAGGGgaagaatttataaatgaaattgttAGCATCAG TAAAACCTCACATGTTAATATAGTTTCTCTGGTGGGATTCTGCTTTGAAGGTCATAAACAAGCACTTGTTTATGAGTTCA TGGCTAACGGTTCGCTTGAAAGGTtcatatatgataaaaaaagttGCCTAGGATGGGAAAAATTGTATGAAATTGCAATT GGAATAGCTCGAGGGCTTGAGTATCTACATGGCGGATGCAACACTCAAATCTTGCATTTCGATATCAAACCTCATAATAT ACTTCTAGATGAATATTTTTGTCCGAAGATTGCAGATTTTGGACTTTCTAAACTATGtcctagaaaagaaaattttactt cAATGGAAGATGCAAGAGGTACTGTTGGATACATTGCTCCTGAAGTATATAACAGATGCTTTGGAAAAGTTTCGCATAAA TCCGATGTGTATAACTATGGAGTGATGATTTTAGAAATGGTAAGTGGAAGGAAGAATGCAAATGTTATGGCGGAAAATAG AAGGAAGATTTATTTCCCACATTGGATCTACACTCGTCTGCAACTCGAAAATGATCTGGGGCTATGTTCTGTTAGGacca aagaagaagatgaaattGCAAGAAAAATGACCATAGTAGGCCTATGGTGCGTACAGACCAATCCTTCACAAAGACCTTCA ATGAGTCAGGTTTTGTTTATGTTACAAGTTTCCAGTGATTCACTGGAAATTCCTCCGATGCCTTTTAAAGTTTCTCCTCA AAGTTCATCAAGTAAC
Gene structure

JCDB Genes gff download

JCDBG25295 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR33783
ID
JCDBR33783
Name
XM_012237671.1
Type
Scaffold
NW_012130064.1
Start
926432
End
927327
Strand
+
Exon
926432-927198,927303-927327
Sequence
TGACAGGCTCGTTCAAGAATAAGTTAGGCCATGGAGGTTCTGGAAGTGTATACAGAGGAAGGCTGCAAGATGGTCGTCCT GTGGCGGTGAAGATCCTTAATGAAAATCTGAAAGGGAAACGGCAAGGGgaagaatttataaatgaaattgttAGCATCAG TAAAACCTCACATGTTAATATAGTTTCTCTGGTGGGATTCTGCTTTGAAGGTCATAAACAAGCACTTGTTTATGAGTTCA TGGCTAACGGTTCGCTTGAAAGGTtcatatatgataaaaaaagttGCCTAGGATGGGAAAAATTGTATGAAATTGCAATT GGAATAGCTCGAGGGCTTGAGTATCTACATGGCGGATGCAACACTCAAATCTTGCATTTCGATATCAAACCTCATAATAT ACTTCTAGATGAATATTTTTGTCCGAAGATTGCAGATTTTGGACTTTCTAAACTATGtcctagaaaagaaaattttactt cAATGGAAGATGCAAGAGGTACTGTTGGATACATTGCTCCTGAAGTATATAACAGATGCTTTGGAAAAGTTTCGCATAAA TCCGATGTGTATAACTATGGAGTGATGATTTTAGAAATGGTAAGTGGAAGGAAGAATGCAAATGTTATGGCGGAAAATAG AAGGAAGATTTATTTCCCACATTGGATCTACACTCGTCTGCAACTCGAAAATGATCTGGGGCTATGTTCTGTTAGGacca aagaagaagatgaaattGCAAGAAAAATGACCATAGTAGGCCTATGGTGCGTACAGACCAATCCTTCACAAAGACCTTCA ATGAGTCAGGTTTTGTTTATGTTACAAGTTTCCAGTGATTCACTGGAAATTCCTCCGATGCCTTTTAAAGTTTCTCCTCA AAGTTCATCAAGTAAC
Product
probable receptor-like protein kinase At1g67000
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237671.1
JCDBP29714
ID
JCDBP29714
Parent
JCDBR33783
Name
XP_012093061.1
Scaffold
NW_012130064.1
CDS
926432-927198,927303-927327
Strand:
+
Sequence
MTGSFKNKLGHGGSGSVYRGRLQDGRPVAVKILNENLKGKRQGEEFINEIVSISKTSHVNIVSLVGFCFEGHKQALVYEF MANGSLERFIYDKKSCLGWEKLYEIAIGIARGLEYLHGGCNTQILHFDIKPHNILLDEYFCPKIADFGLSKLCPRKENFT SMEDARGTVGYIAPEVYNRCFGKVSHKSDVYNYGVMILEMVSGRKNANVMAENRRKIYFPHWIYTRLQLENDLGLCSVRT KEEDEIARKMTIVGLCFSSKFIK
Product
probable receptor-like protein kinase At1g67000
Source
Gnomon
Link
XP_012093061.1
InterProScan
IPR000719 Protein kinase domain
IPR008271 Serine/threonine-protein kinase, active site
IPR011009 Protein kinase-like domain
IPR017441 Protein kinase, ATP binding site
Pfam
PF00069.21 Pkinase Domain