Detail information of JCDBG25297

JCDBG25297
ID
JCDBG25297
Name
LOC105650703
Type
protein_coding
Scaffold
NW_012130064.1
Start
929662
End
931529
Strand
-
Link
Genbank id:105650703
Molecular function
GO:0005524 | ATP binding
GO:0004672 | protein kinase activity
Cellular component
Biological process
GO:0006468 | protein phosphorylation
KEGG
Source
Gnomon
TF
Description
LEAF
Sequence
GACAGTTCAAAGGTGCCACTAAAAGTTGGTATTGGTAAGCGACTCCCTCTTCATCTTAATTTTCTCAGGTCCTTTATCCA AATTCTTACCTTATCATGTCTAAATggcaaagaaataaatttcttgCACACTAAAATGTCACTGAGAATATCTATTGCGT CATATCTTTTCTCAAACAGGTGTAGCAGCAGGTTTTGGAAGTGTAATCATAACATGCATAATCTTCTATATTTATCTAAG ACGCAAGAAAAAAGCATATAATCCATCTTCCTATATCTCTCAAAGCAACACATCAGATTACTCTTCTTCGAAGTCAGATG TTGAGAAAGGAGGTAGCTACTTCGGTGTTCATCTTTTCACCTATGGTGAACTTGAAGAGGCTACAAACAATTTTGATTCT GCTAAAGAGCTTGGAGAAGGAGGTTTTGGCTCTGTATACCATGGTAAGGACAAACTTTGGGCCGTTTggcattaaaattt aaactatttttcCAGAACAAATGTCATTTGAGATGCTGTAGAAAAGGAGTTTTGGAGTGTTGTTTTTAAAGTTTACTTCA ATGATCTATAATCAATATTCTCAATTTAGTACTTTTTTCAATAGCAGCTTaaacaataattcaaaataatgcCTTTATAT CTATTGacaattcttatttaaatgaaCAATTGATCACAAATATTCTTTCTTGCAAATTAGGCACACTTCGAGATGGACGT GTTGTTGCAGTTAAGCGCCTGTACGAAAACAACTACAAAAGAGTTGAGCAGTTCATGAATGAAGTTGATATCCTAACTCG GTTACGCCATCCAAATCTTGTGACACTATATGGCTGCACATCCCGCCACAGCCGTGAACTTCTGTTAGTGTATGAGTACA TTCCTAATGGTACAGTTGCTGATCATCTTCATGGAGAAAGAGCAAAGCCTGGTGAACTCCAATGGTCTACTCGAATGAAA ATTGCTATAGAGACTGCTAGTGCATTAGCTTATCTCCATGCTTCAGATATCATACACCGCGATGTGAAAACCAACAACAT TCTTCTTGACAACAATTTTTGTGTTAAAGTTGCAGATTTTGGATTGTCTCGCCTCTTTCCACTAGATGTTACACATGTTT CCACTGCTCCACAAGGAACTCCTGGCTATGTCGATCCGGAGTATCACCAATGCTATCAGTTGACTGATAAAAGTGATGTC TACAGTCTTGGAGTAGTCTTAGTTGAGCTTATATCATCAATGCCAGCTGTTGATATCACGAGGCACCGgcatgaaattaa tttgtCTAATATGGCAATCAATAAGATACAGAGCGGTGCATTAGATGAACTTGTTGATCAAAGTCTCGGATTTCAATCAG ACTATGCAGTAAGAAAAATGATAACTGCAGTTGCCGAGTTAGCATTTCAATGTCTACAAAGCGCGAAAGAGTTAAGACCA TCTATGGAAGAAGTGTTGGAAACTTTAAAGAAGATTCAAAATAAGGGTTACAATATTGAAAAGGCAGAGGAAGTTGATAT TCCATCAGATGATGTTGGATTGCTGAAAAGTGGTCCTTTGCCACTTTCTCCTGATACTGTTATGATAAAATGGATAAGCA ATTCTTCAACAGCTAGTATCAGTAGCTGAGTTTTGCTTCTTTCACTGTGTTTTCAAGTACAATTTCAGTTCTTGGAAGgg atgtatatatatgatttgagAAGGTGAGATGTGTGTTCTATATGCTTAATGTTCTCCTTCTGCTTATTATTCTTTAGGTG ATTTTTGCCTTTTTACTAATCGattatatattagttaaaaaaatattgctttATTCATTGAACTGACACTGTAATGTATC TTAGAAATAAATTCTGTATATCTTGATA
Gene structure

JCDB Genes gff download

JCDBG25297 's gene expression heatmap with it's positive (above) and negative (bellow) co-expressed neighbours

Mouse click the small gray square will display sample information.

JCDBR33785
ID
JCDBR33785
Name
XM_012237646.1
Type
Scaffold
NW_012130064.1
Start
929662
End
931529
Strand
-
Exon
929662-930830,931088-931351,931497-931529
Sequence
GACAGTTCAAAGGTGCCACTAAAAGTTGGTATTGGTAAGCGACTCCCTCTTCATCTTAATTTTCTCAGGTCCTTTATCCA AATTCTTACCTTATCATGTCTAAATggcaaagaaataaatttcttgCACACTAAAATGTCACTGAGAATATCTATTGCGT CATATCTTTTCTCAAACAGGTGTAGCAGCAGGTTTTGGAAGTGTAATCATAACATGCATAATCTTCTATATTTATCTAAG ACGCAAGAAAAAAGCATATAATCCATCTTCCTATATCTCTCAAAGCAACACATCAGATTACTCTTCTTCGAAGTCAGATG TTGAGAAAGGAGGTAGCTACTTCGGTGTTCATCTTTTCACCTATGGTGAACTTGAAGAGGCTACAAACAATTTTGATTCT GCTAAAGAGCTTGGAGAAGGAGGTTTTGGCTCTGTATACCATGGTAAGGACAAACTTTGGGCCGTTTggcattaaaattt aaactatttttcCAGAACAAATGTCATTTGAGATGCTGTAGAAAAGGAGTTTTGGAGTGTTGTTTTTAAAGTTTACTTCA ATGATCTATAATCAATATTCTCAATTTAGTACTTTTTTCAATAGCAGCTTaaacaataattcaaaataatgcCTTTATAT CTATTGacaattcttatttaaatgaaCAATTGATCACAAATATTCTTTCTTGCAAATTAGGCACACTTCGAGATGGACGT GTTGTTGCAGTTAAGCGCCTGTACGAAAACAACTACAAAAGAGTTGAGCAGTTCATGAATGAAGTTGATATCCTAACTCG GTTACGCCATCCAAATCTTGTGACACTATATGGCTGCACATCCCGCCACAGCCGTGAACTTCTGTTAGTGTATGAGTACA TTCCTAATGGTACAGTTGCTGATCATCTTCATGGAGAAAGAGCAAAGCCTGGTGAACTCCAATGGTCTACTCGAATGAAA ATTGCTATAGAGACTGCTAGTGCATTAGCTTATCTCCATGCTTCAGATATCATACACCGCGATGTGAAAACCAACAACAT TCTTCTTGACAACAATTTTTGTGTTAAAGTTGCAGATTTTGGATTGTCTCGCCTCTTTCCACTAGATGTTACACATGTTT CCACTGCTCCACAAGGAACTCCTGGCTATGTCGATCCGGAGTATCACCAATGCTATCAGTTGACTGATAAAAGTGATGTC TACAGTCTTGGAGTAGTCTTAGTTGAGCTTATATCATCAATGCCAGCTGTTGATATCACGAGGCACCGgcatgaaattaa tttgtCTAATATGGCAATCAATAAGATACAGAGCGGTGCATTAGATGAACTTGTTGATCAAAGTCTCGGATTTCAATCAG ACTATGCAGTAAGAAAAATGATAACTGCAGTTGCCGAGTTAGCATTTCAATGTCTACAAAGCGCGAAAGAGTTAAGACCA TCTATGGAAGAAGTGTTGGAAACTTTAAAGAAGATTCAAAATAAGGGTTACAATATTGAAAAGGCAGAGGAAGTTGATAT TCCATCAGATGATGTTGGATTGCTGAAAAGTGGTCCTTTGCCACTTTCTCCTGATACTGTTATGATAAAATGGATAAGCA ATTCTTCAACAGCTAGTATCAGTAGCTGAGTTTTGCTTCTTTCACTGTGTTTTCAAGTACAATTTCAGTTCTTGGAAGgg atgtatatatatgatttgagAAGGTGAGATGTGTGTTCTATATGCTTAATGTTCTCCTTCTGCTTATTATTCTTTAGGTG ATTTTTGCCTTTTTACTAATCGattatatattagttaaaaaaatattgctttATTCATTGAACTGACACTGTAATGTATC TTAGAAATAAATTCTGTATATCTTGATA
Product
probable serine/threonine-protein kinase At1g18390
Source
Gnomon
Link:
Dbxref=Genbank:XM_012237646.1
JCDBP29715
ID
JCDBP29715
Parent
JCDBR33785
Name
XP_012093036.1
Scaffold
NW_012130064.1
CDS
929902-930830,931088-931351,931497-931529
Strand:
-
Sequence
MDTHLFLPSHVHSMITLFFLLLFVSSSYCEDDKHYTECSKPFSCGNLTGLYYPFWSDERSIICGDPRFKLRCEEDQFPVL SITNQDFRLLSVDYSGQTTIKIVRMDLSESICPVNIAEIRPITIDNALFLDEKEVQKVTLFYNCSAETPAIPNHGFLCDV NGEERPAYYATGEWEIDQLSNYCTIELQVPIPRNDIEEISNGLQNFERVLNAGFNVVYKLDKMCERCSNSSGICGTNSIT SSFTCLCHDRPYATNCPKVDSSKVPLKVGIGVAAGFGSVIITCIIFYIYLRRKKKAYNPSSYISQSNTSDYSSSKSDVEK GGSYFGVHLFTYGELEEATNNFDSAKELGEGGFGSVYHGTLRDGRVVAVKRLYENNYKRVEQFMNEVDILTRLRHPNLVT LYGCTSRHSRELLLVYEYIPNGTVADHLHGERAKPGELQWSTRMKIAIETASALAYLHASDIIHRDVKTNNILLDNNFCV KVADFGLSRLFPLDVTHVSTAPQGTPGYVDPEYHQCYQLTDKSDVYSLGVVLVELISSMPAVDITRHRHEINLSNMAINK IQSGALDELVDQSLGFQSDYAVRKMITAVAELAFQCLQSAKELRPSMEEVLETLKKIQNKGYNIEKAEEVDIPSDDVGLL KSGPLPLSPDTVMIKWISNSSTASISS
Product
probable serine/threonine-protein kinase At1g18390
Source
Gnomon
Link
XP_012093036.1
InterProScan
IPR000719 Protein kinase domain
IPR008271 Serine/threonine-protein kinase, active site
IPR011009 Protein kinase-like domain
IPR013320 Concanavalin A-like lectin/glucanase domain
IPR017441 Protein kinase, ATP binding site
IPR032872 Wall-associated receptor kinase, C-terminal
Pfam
PF14380.2 WAK_assoc Domain
PF00069.21 Pkinase Domain